KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_08965Help
Entry
XFLM_08965        CDS       T01979                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xff00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XFLM_08965
Enzymes [BR:xff01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     XFLM_08965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1950037..1950645
Genome map
AA seq 202 aa AA seqDB search
MQHEGSNNAAFMPMTEVDVVSGYMREYGMTSVLLSLGSNVRPRYYLSQAEAALHAFFGEV
LFSPVYRTLAVGFDGPDFLNSAAMVHTAMSLSDLLAWLQVAWLHALEERYGRDRAEPRFG
NRTLDVVFYGDLIVKEPGGEYCIPRRELKHSFVLKPLVDVAPDFVDPVSGRTLAQLWAVH
PHVDACFQAVDLEVPGDDRDMI
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcacgagggcagcaataacgctgcattcatgcccatgacggaggttgacgttgtc
tctggttacatgcgcgaatatggcatgactagtgtgcttctgagtttaggtagtaatgtt
cgtcccaggtattacttgagtcaggcagaagctgcattgcacgctttttttggtgaagtg
ttgttttctcctgtctaccgcactttggctgtgggttttgacggtccggatttccttaat
agtgctgccatggtgcataccgctatgtctctgtcagatttgcttgcatggttgcaggtt
gcatggttgcatgcgttggaggaacgctatggccgtgatcgcgccgagccgcgttttggt
aaccgtaccctggatgtggtgttctatggtgatctgatcgtgaaagaaccaggtggggaa
tactgtattccacgccgtgagttgaagcatagttttgtgcttaaaccattagtggatgtg
gcaccggattttgtcgatccagtcagtgggcgtaccttggcgcagttgtgggcggtgcat
ccacacgtcgacgcatgtttccaggccgtggatcttgaagtacccggtgacgatagagac
atgatttag

DBGET integrated database retrieval system