KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_09415Help
Entry
XFLM_09415        CDS       T01979                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xff00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XFLM_09415
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XFLM_09415
  Amino acid metabolism
   00310 Lysine degradation
    XFLM_09415
Enzymes [BR:xff01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     XFLM_09415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2056073..2057248)
Genome map
AA seq 391 aa AA seqDB search
MSTEVKVPVLPESVSDATIASWHKKAGEIVKRDENIVDLETDKVVLEVPSPVDGVLKEIK
FDAGSTVTSNQVLAIIEEGSIVTAPSPAPSQVIDQKPVAVSAPAAKSNVDSLPPGARFTA
TTEGIDPAQIEGSGRRGAVTKEDIINFAKQNGAARASGTRLEERIPMTRIRQRIAERLMQ
SKNSTAMLTTFNEINLAKVSNIRKELQEEFQKAHGIKLGFMSFFVKAAANALQRFPLVNA
SIDGTDIIYHGYSDISIAVSTDKGLVTPVLRNVERMSFADIEHRIADYAKKARDGKLSLE
ELQGGTFTVTNGGTFGSLLSTPIVNPPQSAILGMHTIKERPIAENGNIVIAPMMYVALSY
DHRIIDGKDSVQFLVDIKNQLEDPGRMLFGL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgaagttaaagtcccggtattacctgaatccgtttcagacgccaccattgcc
agctggcacaaaaaagccggtgagattgtcaaacgcgatgagaacatcgtcgacctggag
accgacaaagttgtattggaagtcccctcccctgtcgacggcgtcttgaaagaaatcaaa
ttcgacgccggcagtactgtcaccagtaatcaagttctggcaatcattgaagaaggcagc
atcgttactgcaccctctccagcaccctctcaggtgattgatcagaaaccggttgctgta
tccgctccagccgccaaatccaacgttgacagtctgcctccaggtgctcgtttcacggca
acgaccgaaggtattgacccagcccagatcgaaggaagtgggcgccgtggtgctgtcacc
aaagaagatatcatcaactttgctaagcaaaatggagccgcccgcgccagcggtacgcgt
ttagaagaacgcatcccaatgacccgtatccggcaacgcatcgccgaacgcctcatgcag
tcgaagaactccactgcgatgctgaccacctttaatgaaatcaacctggccaaagtctca
aacatacgcaaagagctacaggaagaattccagaaagcccacggtatcaaattgggcttc
atgagctttttcgtgaaagccgccgccaatgcactacagcgcttccccttggtcaacgca
tcaattgacggtacagacatcatttaccacggatatagcgatatttcgatcgcggtatcc
accgataaaggcttagtcacgccagtactgcgcaacgtcgaacggatgtctttcgccgac
attgagcatcgcatcgccgattacgccaagaaggcacgcgacggcaaattaagtctagaa
gagttgcagggaggcaccttcaccgtcaccaacggtggcacctttggctcattgctctcg
actccaatcgttaacccgccacaaagcgcgattttagggatgcataccatcaaagagcgc
cccattgctgagaacggcaacattgtgattgcgccaatgatgtacgtggcactgtcatat
gatcaccgcatcattgatggcaaagattcggttcaattcttggtggacatcaaaaatcaa
ttggaagaccccgggcggatgctgttcggcttataa

DBGET integrated database retrieval system