KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_10215Help
Entry
XFLM_10215        CDS       T01979                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xff00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XFLM_10215 (gpmA)
   01230 Biosynthesis of amino acids
    XFLM_10215 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XFLM_10215 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    XFLM_10215 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XFLM_10215 (gpmA)
Enzymes [BR:xff01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     XFLM_10215 (gpmA)
Exosome [BR:xff04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   XFLM_10215 (gpmA)
  Exosomal proteins of melanoma cells
   XFLM_10215 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2227529..2228278)
Genome map
AA seq 249 aa AA seqDB search
MTRKLVLLRHGQSQWNSMNRFTGWVDIGLTEQGHQEATMAGHLMKKEGLEFDVAHTSLLK
RAIHTLQDALKALDQDWLPIYKSWRLNERHYGALQGLDKIDTAAKHGEEQVNIWRRSYDI
QPPPIDLDDPSHPMRDRRYAALDRKVLPVRESLKNTLERVLPYWNDAIAPQLNDNKTVLI
SAHGNSLRALYKYLNKESDEKILNVNIPTGIPLLFELSDTLQVVSYRYLGDPDAAQRAAE
MVANQGKAK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtaaacttgtattgctacgccatggacagagtcaatggaactcaatgaaccgt
tttactggctgggtggatatagggctgaccgaacaaggtcatcaagaagccactatggct
ggtcatctgatgaaaaaagaaggactagagtttgatgtcgctcatacttctttacttaag
cgggcgatccatacattacaagacgcacttaaagcattggaccaggactggttaccaatt
tataaaagctggcgtctcaatgagcgtcactacggtgctctacaaggccttgataaaata
gataccgcagctaaacatggtgaagagcaagtcaatatttggcgccgctcctatgacatc
cagccgccaccgattgatctagatgacccaagccatccaatgcgagaccgccgttacgcc
gctttggaccgcaaagtattacctgtgagggaatcgctgaaaaatacactcgaacgagta
ttaccgtactggaatgatgccatcgcaccacaactaaatgacaacaagacggtacttatt
agcgcccacggcaactcattgcgtgcgttgtacaagtaccttaataaagaaagtgatgag
aaaatcctaaatgtcaatatccctactggcattccacttctatttgaactgagcgataca
ctacaagtagtgagttaccgttaccttggcgatccagatgcagcacaacgcgctgccgaa
atggtagcaaaccaaggtaaggcgaagtaa

DBGET integrated database retrieval system