KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_11040Help
Entry
XFLM_11040        CDS       T01979                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
xff03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:xff00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    XFLM_11040 (recR)
DNA repair and recombination proteins [BR:xff03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     XFLM_11040 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      XFLM_11040 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 TniQ HHH
Motif
Other DBs
NCBI-ProteinID: ADN64068
Position
complement(2363408..2364004)
Genome map
AA seq 198 aa AA seqDB search
MSTHLLEQLIDAFRILPGVGQKTAQRMAYHMLEREREGGQRLADVLSRAIEKIGHCTECR
DFSETKICAICANSSRDRHQLCVVESPPDRLAIEQATGYRGLYFILQGRLSPLDGIGPHE
LGLDHLGQRLAAGEVTELIIATNATVEGETTAHYLALLARQHGIRPSRLAQGLPLGGELE
YLDRGTLSHAFGTRTEVV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgagtacacatttgcttgagcagttaattgacgccttccgtatcttgccaggtgtcggt
cagaagaccgcgcagcgtatggcctaccatatgcttgagcgcgagcgtgaaggtggacag
cgcttggctgatgtgctgagccgtgcgattgagaaaattggtcattgtacggagtgtcgt
gacttcagtgagaccaaaatctgtgcgatctgcgctaactccagccgtgaccgtcatcag
ttgtgcgtggtcgagtccccccctgatcggctggcgattgagcaagccactggctaccgt
ggactatattttattttgcaggggcgcctgtccccgctggatgggatcggccctcatgaa
cttgggttggaccatttaggacaacgtcttgctgcaggtgaggtgacggagctcatcatt
gcgactaatgcgacggtggagggtgagacgacagcgcactacttagcgctcctggcgcgc
caacacggtatacgccccagccgactggcacaaggtttgcccttgggtggggagctggaa
tacttagaccgcggcactctttcgcacgcgttcggcacccgtactgaagtggtctga

DBGET integrated database retrieval system