KEGG   Xylella fastidiosa subsp. fastidiosa GB514: XFLM_11110Help
Entry
XFLM_11110        CDS       T01979                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
xff  Xylella fastidiosa subsp. fastidiosa GB514
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xff00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XFLM_11110
Enzymes [BR:xff01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     XFLM_11110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2373160..2373933
Genome map
AA seq 257 aa AA seqDB search
MTRPDQARTPWYLLSLRPANNHAALRRAVARYGGGLIALSPWRLKRLDSPETRSALASAL
TASTLVFTSPEAVRAAHALQTLRTSPGQVWLCVGASTARVLQQCGITRVLHPTQMNSEGL
LTLLAQQPPTEVGLITAPGGRDLLQQKLLENGIRLHRADVYERQPLRLRTATLDTLQRNA
TRSLLALSSAEALALLLPQWPDNLRRILYQRPVIATSKRLEDLACARGFISVYRATGPLP
RQLAATAAAFRPDKTAQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacaagaccagaccaagcccgcaccccatggtatttgttgtcactacgtccggcaaac
aaccacgccgcactgcgccgtgccgtcgcgcgttacggaggaggattaatcgcactatcc
ccgtggcgattaaagcgtctagacagtccagagacacgctctgcattagcatcagcattg
acggcatcaaccctggttttcaccagtccagaggcagtacgtgcggcacatgctctgcaa
acgctacgcacttcacctggacaagtatggttgtgcgttggcgcaagcactgcacgcgtg
ctacaacagtgcggtattacacgcgtgttgcacccaacacaaatgaacagtgaagggtta
ctcacattactggcacagcaacccccaaccgaagttggacttattaccgcaccaggagga
cgtgatttactccagcagaagcttttagaaaatggcatacggttacatcgtgccgatgtc
tacgaacgtcaaccgttacgtctgcgcacagccacattggatacactccagcgtaatgcc
acacgtagcctgcttgcactgagcagtgccgaagctttagcactcttactgccacaatgg
ccggataacctgcgaaggatcctgtaccagcgtccagtgattgcaacaagcaaacggcta
gaagatctagcatgcgcgcgaggatttatcagcgtttatcgcgccacaggaccattgccg
cgccagttagcagcaacagcagcggcttttcgacccgataaaacagcacaatga

DBGET integrated database retrieval system