KEGG   Xylella fastidiosa M12: Xfasm12_0072Help
Entry
Xfasm12_0072      CDS       T00677                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
xfm  Xylella fastidiosa M12
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:xfm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(89170..90066)
Genome map
AA seq 298 aa AA seqDB search
MFDTIPTLHCAGRTLRLDSPLVMGILNVTPDSFSDGGLHDSVDAAVAHGLRLIAEGADII
DIGGESTRPGAAPVPLEEELLRVVPVIKALTAYDKAVISVDTFKPEVMRAAVAAGAGLIN
DIYALRTPGALEAAAELAVPVILMHMKGEPHSTQTPQYDHVVDEVYRFLAERIFAAEIAG
IERHRLLIDPGFSFNKTTEHNIALLAALERFTNLGIPLLAGLSRKRSLGELTGRQLPIER
VYASVAAHLIAVQRGALIVRVHDVAAMIDALKVWQAVSAAAAPATHTKTTVARSPNDD
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtttgacactatcccaaccctgcactgcgccgggcgcaccttgcgtctagacagtcca
ttggtcatgggtatcctcaacgtgactcctgattctttttccgacggaggcctgcatgac
tctgtggatgcagcagtggcgcatggattacgtctgattgctgagggtgcagacatcatt
gatattggcggggaatccacccgtcccggtgcagcgccggtaccgctggaggaggaacta
ctccgagtggtgccggtcatcaaggcattaactgcctacgataaagctgtcatcagcgta
gacaccttcaaacctgaggtaatgcgtgcggcagtcgcggccggtgccggcttgatcaac
gacatctatgcactacgcactcccggagcgctggaagcagcagcagaactggctgtacca
gtaatattgatgcatatgaaaggtgagccgcactcaacgcaaacaccacagtacgatcat
gtggttgatgaagtgtaccgtttcctggccgagcggatttttgccgccgagatagcaggt
atcgaacgacaccgactgttgatcgatcctggtttcagtttcaacaagaccacggaacat
aacattgcactgttagcggcactggagcgtttcaccaatctcggcatcccattgttggcc
ggattgtcacgcaagcgtagcttgggcgaactgacaggacgtcagttaccaatcgaacgc
gtgtacgcctccgtcgctgcacatctcattgcggtacaacgcggcgcgttaatcgtacgg
gtgcatgatgtggcggctatgatcgatgccctcaaagtttggcaggcagtttcagcagcg
gctgcacctgcaacacatactaaaactacagtggctcgttcgcccaatgacgactga

DBGET integrated database retrieval system