KEGG   Xylella fastidiosa M12: Xfasm12_0112Help
Entry
Xfasm12_0112      CDS       T00677                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
xfm  Xylella fastidiosa M12
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:xfm00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:xfm00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:xfm03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:xfm03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:xfm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(133271..133696)
Genome map
AA seq 141 aa AA seqDB search
MARADFYLISKPRFLEKPLQLVCELVRKAYDTHQPALILARDQAQAEALDDLLWAFDPDA
YIPHQIAGSDEDDDITPVLIATPDSDTPSRPLVINLRDAPWDGPCERVLEVVPADPAARE
PLRERWKHYKTRGLHMNKHDM
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcgccgacttctatttgatttccaaaccgcgctttcttgagaaaccgctgcaa
ttagtctgcgaattagtccgcaaagcctacgacacccatcagcccgcgctgattctggcc
cgcgaccaagcccaggccgaagcactggatgacctactgtgggcgttcgacccggacgcc
tacatcccccaccaaatcgccggcagcgacgaagacgacgacatcacccccgtattgatt
gccaccccggacagcgacaccccatcgcgcccgctggtcatcaacctacgcgacgcccct
tgggacggcccctgcgaacgcgtgttggaggtggtccccgccgatcctgcggcacgcgag
ccactgcgtgaacgctggaaacactacaagacacgcggcctgcacatgaacaaacacgac
atgtga

DBGET integrated database retrieval system