KEGG   Xylella fastidiosa M12: Xfasm12_0128Help
Entry
Xfasm12_0128      CDS       T00677                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
xfm  Xylella fastidiosa M12
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xfm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Xfasm12_0128
   00030 Pentose phosphate pathway
    Xfasm12_0128
   00051 Fructose and mannose metabolism
    Xfasm12_0128
   00052 Galactose metabolism
    Xfasm12_0128
   00500 Starch and sucrose metabolism
    Xfasm12_0128
   00520 Amino sugar and nucleotide sugar metabolism
    Xfasm12_0128
  Nucleotide metabolism
   00230 Purine metabolism
    Xfasm12_0128
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Xfasm12_0128
Enzymes [BR:xfm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Xfasm12_0128
    5.4.2.8  phosphomannomutase
     Xfasm12_0128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
152288..153775
Genome map
AA seq 495 aa AA seqDB search
MQEAPERAIVLNEENNVALSSSLHLQFNLEALVQPSLFHEDDIHGVVPGELNPGVAKLIG
QAIGSAMQAKGLSDIVIGRDGRVSSSELSAALSDGLRHAGCNVVDIGLVPIPVVYFAACH
LGVGSCVAVTGGHHPHDYNGFKIVLGGESLSSEAMSDLYQCITNGRLYASVDSGSLSERD
VVDDYIQRIADDVQLNRPLKIVADPGHGAAEEILSRLFKAIGADLVSLYGDIDGVSLIVH
PDSDEPGNLQKLIQRVEQADADLGLAFDGDAASLRVVTREGEVILSDSVLMLFATDVLQR
NPGALVIYDAECTSKLSDYVLRNGGSPLMWKTGHSSIKAKMRETGAELAGEMSGYFFFKE
GWYGFEDALYAAARLLEILAQREDNPSQVFAALPHAYFTAQMEQSVEGDAQACVQSFIEE
VQRSVEGGVFDGARLFAFDGLRADFTDGWGLVRVSDTASALVLRFEADTQAGLERIQSAF
RTHLQALLPGQVLVF
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaggcgccggagcgcgcgatcgttttgaatgaggaaaacaacgttgcgttgtcg
tcgtcgctgcatcttcagttcaatttggaagcgttggttcaacctagtcttttccatgaa
gacgatatccacggtgtggtccctggcgagttgaacccaggtgtggcgaagttgatcggt
caagcgatcggcagtgcgatgcaggccaaaggtttgagtgacattgtgattggccgtgac
ggccgcgtgtccagttctgagttgtccgcggcattaagtgatggtctacgtcatgccggt
tgcaatgtggtagacatcggcttggtgccgatcccggtagtgtatttcgctgcctgccat
cttggcgttggtagttgcgttgcggtcacaggggggcatcatcctcatgattacaacggt
ttcaagatcgtgcttggtggtgagtccttatccagtgaggcgatgagcgatttgtatcaa
tgcatcaccaatggtcgcttatatgcgtccgttgactccggcagtttgagtgagcgtgat
gtggttgacgattacattcagcgtattgccgatgatgtgcagttgaatcgtccgctgaag
attgttgctgatcctggtcacggtgcggctgaagagatcctgtcacgtttattcaaggcg
attggtgcggatctggtgtcactgtacggtgatattgatggtgtttcccttattgtccat
cctgattcggacgagccagggaatctgcagaagctgattcagcgggttgagcaggccgat
gccgatttgggtcttgcttttgatggggatgcggcaagtctcagagtggtgactcgagaa
ggtgaggtcattttatcggatagcgtgttgatgttgtttgcgacggatgtgctacagcgg
aatccgggtgctttggtgatctatgatgctgaatgtactagcaagttgtctgattatgta
ttgcgcaacggcggcagcccgttgatgtggaagaccgggcattcctccatcaaagctaag
atgcgcgagaccggtgccgagttggctggtgaaatgagtggctatttcttcttcaaagaa
ggctggtatggtttcgaggatgctctgtatgcggcggcgcgtttgctggagatcttagcg
cagcgcgaggataatccgtcccaggtgtttgctgcattgccccatgcttatttcactgcg
caaatggagcagtctgtcgagggtgatgcgcaggcatgtgtacagtcctttattgaggaa
gtgcagcgtagcgttgagggcggtgtgttcgatggtgctcgtttgttcgcctttgatggt
ttgcgtgctgatttcactgatggttgggggctagtacgcgtttctgacactgcatctgca
ctggtgttgcgttttgaggctgacacgcaggctggattggagcggattcagagtgcattc
cgcacgcatctgcaggcattactacccggtcaggtactggtgttctaa

DBGET integrated database retrieval system