KEGG   Xylella fastidiosa M12: Xfasm12_0159Help
Entry
Xfasm12_0159      CDS       T00677                                 

Definition
sulfite synthesis pathway protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
xfm  Xylella fastidiosa M12
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xfm00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Xfasm12_0159
Enzymes [BR:xfm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Xfasm12_0159
Transfer RNA biogenesis [BR:xfm03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Xfasm12_0159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(194263..195081)
Genome map
AA seq 272 aa AA seqDB search
MAGTSAVITIPSDLHESVIAIATDSGRAIMEIYQDHFQVQIKADMSPLTQADLISHQIIV
HGLKQLTPSLPVLSEESTGITWEERRHWTSYWLVDPLDGTREFVKRNGEFCINIALIHEG
IPVYGMILAPVEGTIWHAMHGGQAFRRDGHRDTTLHVRAPAGTALQVAASRSHIDVHTSA
LLAQMKEITLVSQGSALKFCRLAEGTLDVYPRLGATYEWDTAAGQCLLLAAGGTLLNIET
GKQFRYNKRETLLNSGFIALGDATLPWRDWLP
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggctggaacatcagcagtgatcactattcccagcgatcttcacgaatcggtcatcgcc
attgctacagattccggcagagcgatcatggagatctatcaagatcatttccaggtccag
atcaaagcagacatgagtccattgacgcaggccgatttaatctcacatcagatcatcgtg
catggactcaagcaactgacccccagtctgcccgtgttgtcggaagagtcgacgggaatc
acttgggaggaacgccgtcactggacgagctactggttggtcgatccactcgacggcacc
cgcgaatttgtgaaacgcaatggcgagttttgcataaacatcgcactgatccatgaaggt
atccccgtatatggaatgatcctggcgccggtggaagggaccatctggcatgcaatgcat
ggcgggcaggcattccgccgtgatggtcaccgtgataccacattgcacgtgcgggcacct
gctggcaccgcgttacaggtcgcagccagccgctcgcacattgatgtgcacacctcggcg
ttactggcacagatgaaagaaataaccctagtttcgcagggatcggcgctgaagttctgt
cgccttgctgaaggcacactcgacgtgtacccgcgtctaggcgctacctatgagtgggat
actgccgcaggccagtgcttactgcttgctgcgggcggtacgctactgaacattgagact
ggaaaacagttccgctacaacaaacgcgagacactgcttaacagcggttttatcgcactg
ggcgacgccacgctgccttggcgcgattggttgccctga

DBGET integrated database retrieval system