KEGG   Xylella fastidiosa M12: Xfasm12_0239Help
Entry
Xfasm12_0239      CDS       T00677                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
xfm  Xylella fastidiosa M12
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xfm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Xfasm12_0239
   01230 Biosynthesis of amino acids
    Xfasm12_0239
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Xfasm12_0239
   00030 Pentose phosphate pathway
    Xfasm12_0239
   00051 Fructose and mannose metabolism
    Xfasm12_0239
   00052 Galactose metabolism
    Xfasm12_0239
  Energy metabolism
   00680 Methane metabolism
    Xfasm12_0239
Enzymes [BR:xfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Xfasm12_0239
Protein phosphatases and associated proteins [BR:xfm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Xfasm12_0239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(279504..280787)
Genome map
AA seq 427 aa AA seqDB search
MSSPYKSSSHMAKETLLYAQSGGVTAVINATAAAVITEARSHRVKVLAARNGILGALRED
LIDTSKESITAIRALTHTPGGAFGSCRFKLKSLEADHDKYERLLEVFKAHNVRWFLYNGG
NDSADTALKVSQLAKTFDYPLHCIGVPKTIDNDLAITDASPGFGSAAKYTAVSICEAARD
VAAMAETSTKVFIYEAMGRHAGWLAAAAGLAGQGQEEAPHIILLPERTYDETAFLAKVQQ
VVDRVGWCVVVASEGIRSNDGRFVADAGGTTDAFGHTQLGGVAAYLASRVKQALGLKVHW
TLPDYLQRSARHIASKTDWEQAQAVGKAAVRYALEGMNAVMPVIVRTSDTPYRWKIEPAA
LTKIANHEKTLPASFLRRDGFGISERARTYFEPLIRGEAPMPYERNGLPRHVHLKNQSVQ
KRLPAWE
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcgccctacaagagctcgtcccacatggcaaaagagacgttgttatacgcccaa
tccggcggcgttaccgctgttatcaacgcaaccgccgccgcggtcatcaccgaagcacgg
tcacaccgcgttaaagtcctcgccgcacgcaatggcatcctcggtgcactgcgtgaagac
ctgatcgacacatccaaagaatcaatcacggcaatccgtgccttgacccataccccagga
ggcgcatttggctcgtgccgtttcaagctcaaatcgcttgaagccgatcacgacaagtac
gaacggttacttgaagtattcaaagcacataacgtgcgctggttcctctacaacggtggt
aatgactccgccgatacagcgctcaaagtctcacagttagccaaaacatttgactatcca
ctgcactgtatcggcgtccctaaaaccatcgacaacgatttggcgatcaccgacgccagc
cccggcttcggttcagccgcaaagtacactgctgtctccatatgcgaagccgcgcgggat
gtcgcagcgatggccgagacctcaactaaggttttcatttacgaagcaatgggccgccat
gccggttggctcgctgcggctgctggcttggccggccaagggcaggaagaagccccccac
atcatcctgctccctgaacgcacctacgacgaaacagcatttctggcgaaagtccaacag
gtagtcgaccgggtcggttggtgcgtggtagtcgccagcgaaggtatccgcagcaatgat
gggcgcttcgttgccgatgctggcggcaccactgatgcctttggtcacacgcaacttggc
ggcgtcgccgcttacctcgccagccgagtgaaacaggcactcggactcaaagtgcactgg
acgctgccagattacctacaacgctccgcaaggcacatcgcctccaaaacagactgggaa
caagcacaggctgtgggtaaagctgcagtgcgctacgcactggaaggcatgaatgcagtc
atgcctgtcatcgtacgcacctctgacaccccataccgttggaaaatcgagccggcagca
ctcaccaagattgccaatcacgaaaaaaccttaccagcaagcttcttacgccgtgacggc
ttcggcatcagcgaacgtgcacgcacctactttgaaccattgattcgtggcgaagcaccc
atgccttacgaacgcaacggattaccgcggcacgtccatctgaaaaatcaaagcgtacag
aaacggctacctgcctgggaataa

DBGET integrated database retrieval system