KEGG   Xylella fastidiosa M12: Xfasm12_0267Help
Entry
Xfasm12_0267      CDS       T00677                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
xfm  Xylella fastidiosa M12
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xfm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Xfasm12_0267 (tpiA)
   01230 Biosynthesis of amino acids
    Xfasm12_0267 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Xfasm12_0267 (tpiA)
   00051 Fructose and mannose metabolism
    Xfasm12_0267 (tpiA)
   00562 Inositol phosphate metabolism
    Xfasm12_0267 (tpiA)
Enzymes [BR:xfm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Xfasm12_0267 (tpiA)
Exosome [BR:xfm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Xfasm12_0267 (tpiA)
  Exosomal proteins of bladder cancer cells
   Xfasm12_0267 (tpiA)
  Exosomal proteins of melanoma cells
   Xfasm12_0267 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
313011..313760
Genome map
AA seq 249 aa AA seqDB search
MRPKIVVGNWKLHGSHAFAQALVAQVAAGLPLPGVSVIILPPLLYLSDLTQRFKGEGLAF
GAQNVSHHDKGAYTGEVSAAMVADVGAHYTLVGHSERREYHHEDSELVARKFAAALSAGL
RPILCVGESLPQREAGQAEVAIAMQLAPVLALVGPQGVARGLIAYEPVWAIGTGRHADPS
QVQAMHAFIRGEIARQDARIGDSLLILYGGGIKPCNAAELFSQQDVDGGLIGGASLVADD
FLAIARATV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgccccaagattgtggttgggaattggaagttgcatggtagccacgcgttcgcacag
gcattggttgcgcaggttgctgctggtttgccgctgcctggagtcagtgtgattatcttg
ccgccattgctgtatctgagtgatttgacgcagcgcttcaaaggggaaggtttggcgttt
ggtgcgcagaacgtcagtcaccatgataaaggtgcttacactggggaagtttcggcggcg
atggtggctgatgtcggtgctcattacactttggttgggcattctgaacgtcgggagtat
caccatgaggacagtgagttggtggcgcgtaaatttgctgctgctctgagtgctgggttg
cgaccaattctatgtgttggggagagtttgccccagcgtgaggctggacaggcagaggtt
gccattgcgatgcagcttgcgcctgtgttggctctggttggcccgcagggtgttgcccgt
ggcttgattgcctatgagccggtttgggcgattggtactggccgtcatgcggatccgagc
caagtccaagcgatgcacgcttttattcgtggtgaaattgcgaggcaagatgctagaatc
ggcgattctctgttgattctatacggaggcggcatcaagccttgcaacgctgctgagttg
ttttcccagcaggatgtcgatggtgggttgattggtggtgcttcgttggttgctgatgat
ttcttggctatcgctcgtgcgacggtttag

DBGET integrated database retrieval system