KEGG   Xylella fastidiosa M12: Xfasm12_0373Help
Entry
Xfasm12_0373      CDS       T00677                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
xfm  Xylella fastidiosa M12
Pathway
xfm00010  Glycolysis / Gluconeogenesis
xfm00052  Galactose metabolism
xfm00500  Starch and sucrose metabolism
xfm00520  Amino sugar and nucleotide sugar metabolism
xfm00521  Streptomycin biosynthesis
xfm01100  Metabolic pathways
xfm01110  Biosynthesis of secondary metabolites
xfm01120  Microbial metabolism in diverse environments
xfm01130  Biosynthesis of antibiotics
xfm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xfm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Xfasm12_0373
   00052 Galactose metabolism
    Xfasm12_0373
   00500 Starch and sucrose metabolism
    Xfasm12_0373
   00520 Amino sugar and nucleotide sugar metabolism
    Xfasm12_0373
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Xfasm12_0373
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Xfasm12_0373
Enzymes [BR:xfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Xfasm12_0373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: ACA11387
JGI: Xfasm120373
UniProt: B0U1J8
Position
complement(431435..432448)
Genome map
AA seq 337 aa AA seqDB search
MNAPQAPVLVADIGGTNARFALANPTLTSAPLLNDSMREFAVIEFPSLGEAAQHYLHHIG
IHTTKGVFAIAGHVDGDEARITNHPWVITRTRTATMLGFDTLHLINDFVAQAMAISVLGP
QDVIQIGSAKWEQFPLSAATRNYGIIGPGTGLGVGGLVIRNGRCYPLETEGGHVSFPPST
PEEIRILEILSQQFGRVSNERLISGPGIVNIHRALSEIDGIDPGPLRPQDITMRAADGDI
RATRTINLFCNIFGAITGDLVLIQGAWDGVFLTGGLVPKLLNSIQHSGFRQRFEHKGRFS
AIMARIPSLAVIHPHPGLLGAAVYARDTEQVPQEIKA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaccacaggctcccgtactggtcgcagacattggagggactaacgcccgcttt
gcgctcgccaaccccaccctaacctcagcaccactgctgaacgacagcatgcgcgaattc
gccgtcatcgaattcccctcactgggcgaagctgcacagcactacctgcatcacataggc
atacataccaccaaaggcgtctttgcgatcgccggacacgtagacggcgatgaagcacgt
attaccaatcatccctgggtcatcacacgcacgcgcactgcaacaatgctcggcttcgac
accctgcacctcatcaacgattttgttgcccaagcgatggccatcagcgtgttaggccct
caagatgtcatccaaatcggcagtgccaaatgggagcaattcccgctatcagcagccacc
cgcaactacggcatcattggccccggcaccggcctaggcgtcggcggcctggtgattcgc
aacggccgctgctatccgctagaaaccgagggcggccatgtcagcttcccgccaagcacc
ccagaagaaatccggatcctggaaattctgtcacaacaattcggacgtgtctccaacgaa
cggctgatctccggtccagggatagtcaacattcaccgcgcactgagcgaaatcgacgga
atcgacccaggcccactgcgccctcaagacatcaccatgcgcgccgctgacggcgacata
cgcgccacacgcaccatcaatctgttctgcaacatcttcggcgccatcaccggcgacctg
gtactcatccaaggggcttgggatggcgtctttctgacaggcggcctcgttcccaaacta
ttgaactcaatacaacattccggtttccgccaaagatttgaacataagggtcgattttcg
gccatcatggcccgtatcccctctttggcagtgatccatccacaccctggcctactcggc
gcagccgtatacgcacgagacaccgagcaagtcccgcaggaaatcaaggcatga

DBGET integrated database retrieval system