KEGG   Xylella fastidiosa M12: Xfasm12_0373Help
Entry
Xfasm12_0373      CDS       T00677                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
xfm  Xylella fastidiosa M12
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xfm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Xfasm12_0373 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Xfasm12_0373 (glk)
   00052 Galactose metabolism
    Xfasm12_0373 (glk)
   00500 Starch and sucrose metabolism
    Xfasm12_0373 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Xfasm12_0373 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Xfasm12_0373 (glk)
   00524 Butirosin and neomycin biosynthesis
    Xfasm12_0373 (glk)
Enzymes [BR:xfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Xfasm12_0373 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(431435..432448)
Genome map
AA seq 337 aa AA seqDB search
MNAPQAPVLVADIGGTNARFALANPTLTSAPLLNDSMREFAVIEFPSLGEAAQHYLHHIG
IHTTKGVFAIAGHVDGDEARITNHPWVITRTRTATMLGFDTLHLINDFVAQAMAISVLGP
QDVIQIGSAKWEQFPLSAATRNYGIIGPGTGLGVGGLVIRNGRCYPLETEGGHVSFPPST
PEEIRILEILSQQFGRVSNERLISGPGIVNIHRALSEIDGIDPGPLRPQDITMRAADGDI
RATRTINLFCNIFGAITGDLVLIQGAWDGVFLTGGLVPKLLNSIQHSGFRQRFEHKGRFS
AIMARIPSLAVIHPHPGLLGAAVYARDTEQVPQEIKA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaccacaggctcccgtactggtcgcagacattggagggactaacgcccgcttt
gcgctcgccaaccccaccctaacctcagcaccactgctgaacgacagcatgcgcgaattc
gccgtcatcgaattcccctcactgggcgaagctgcacagcactacctgcatcacataggc
atacataccaccaaaggcgtctttgcgatcgccggacacgtagacggcgatgaagcacgt
attaccaatcatccctgggtcatcacacgcacgcgcactgcaacaatgctcggcttcgac
accctgcacctcatcaacgattttgttgcccaagcgatggccatcagcgtgttaggccct
caagatgtcatccaaatcggcagtgccaaatgggagcaattcccgctatcagcagccacc
cgcaactacggcatcattggccccggcaccggcctaggcgtcggcggcctggtgattcgc
aacggccgctgctatccgctagaaaccgagggcggccatgtcagcttcccgccaagcacc
ccagaagaaatccggatcctggaaattctgtcacaacaattcggacgtgtctccaacgaa
cggctgatctccggtccagggatagtcaacattcaccgcgcactgagcgaaatcgacgga
atcgacccaggcccactgcgccctcaagacatcaccatgcgcgccgctgacggcgacata
cgcgccacacgcaccatcaatctgttctgcaacatcttcggcgccatcaccggcgacctg
gtactcatccaaggggcttgggatggcgtctttctgacaggcggcctcgttcccaaacta
ttgaactcaatacaacattccggtttccgccaaagatttgaacataagggtcgattttcg
gccatcatggcccgtatcccctctttggcagtgatccatccacaccctggcctactcggc
gcagccgtatacgcacgagacaccgagcaagtcccgcaggaaatcaaggcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system