KEGG   Xylella fastidiosa M12: Xfasm12_0379Help
Entry
Xfasm12_0379      CDS       T00677                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
xfm  Xylella fastidiosa M12
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:xfm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Xfasm12_0379
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Xfasm12_0379
   00650 Butanoate metabolism
    Xfasm12_0379
  Energy metabolism
   00190 Oxidative phosphorylation
    Xfasm12_0379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
437257..437640
Genome map
AA seq 127 aa AA seqDB search
MSRYRTPLKNARGLGAAKVGTGHFVLQRLTAIALVLLGVWFLAFLLTLLGVDYAAAVAAV
AKPWNAILLIGFLVAAFWHAQLGLQVVLEDYIHNSFLALALQTMVRFIAVLGAVASVFAV
VRIALGN
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgttaccgtacaccactcaaaaatgcccgtggtctaggtgctgctaaggtgggg
accgggcattttgtgttgcagcgcctcactgcgattgcattagtattgctgggagtatgg
tttttggcatttttgctgactttgcttggtgtcgactatgcagcagcggttgcagccgtc
gccaaaccttggaatgcaatattgctcattggattcctggtcgctgccttttggcatgcg
cagctcggtttgcaggtggtacttgaggattacatccacaactcttttctggctttggca
ctccagacgatggtgagatttatcgctgtccttggcgctgtcgccagcgtttttgcggtc
gttcgtatcgcgcttgggaactga

DBGET integrated database retrieval system