KEGG   Xylella fastidiosa M12: Xfasm12_0585Help
Entry
Xfasm12_0585      CDS       T00677                                 

Definition
arginine deaminase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
xfm  Xylella fastidiosa M12
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:xfm01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:xfm00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
638851..639744
Genome map
AA seq 297 aa AA seqDB search
MKDAMSIIKKKTIRMLFPQWQGGNQELYSLGARLLAWLAPETEAPVFEVNVPDFKKETPE
PERGVIYRQQLFKQYDEAYRLLEREDPDYVVIFGGDCLVDLAPFAWLNEKHHGQLGVLWI
DAHPDIKTPQDSMNGHTMVLGSFLGEGDNEFAAKVKVPLKPSRVMFAGLIETGLTEQESE
VIHRLGLNVAKPEVLFDNSQTVIDWVRKEKIEKLVIHFDLDVLNPDVFRSLLFAEPEPEF
DWRATYPVGQLRLAQVIRLIRDVAAETELVAIGITEHLPWDVWHLKESLSKVPLLNR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacgcaatgagtatcattaagaagaaaacaatcagaatgctttttcctcaatgg
caaggtggaaatcaggagctatatagtttgggtgcacgtcttctggcttggttggcgcct
gaaacagaggctcctgtgtttgaggtgaatgtgcctgattttaaaaaagaaacacccgaa
ccggagagaggggttatctacaggcagcaattattcaagcagtatgatgaagcttataga
ctgttagagcgggaagatccagattatgtggtgatttttggtggtgattgcctggtggat
ttggcgccttttgcttggttgaatgagaaacatcatggtcagttgggtgtgttatggatt
gatgctcatcctgatataaaaacaccgcaggattctatgaatggtcacacgatggttctg
ggaagttttctgggtgaaggtgataacgaatttgccgcaaaagtgaaagttccgttgaag
ccgtccagggtgatgtttgcagggttgattgaaacagggttgacggagcaggagagtgag
gtaattcatcgccttggactcaatgtggccaaaccggaggtgttatttgacaacagccag
acggtgattgattgggtccgtaaggaaaaaattgagaagttggtgattcatttcgatctg
gacgttcttaatcctgatgtattccgctcgttgttatttgctgaaccggagccggaattc
gattggcgggcaacttaccctgttgggcaattgcgtttggcacaggtgatcaggttgatt
cgcgatgttgccgctgaaacggagttggtggcgattggcataactgagcatcttccttgg
gatgtttggcacttgaaggagtctttaagtaaggttccattactgaatcggtaa

DBGET integrated database retrieval system