KEGG   Xylella fastidiosa M12: Xfasm12_0728Help
Entry
Xfasm12_0728      CDS       T00677                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
xfm  Xylella fastidiosa M12
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xfm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Xfasm12_0728
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Xfasm12_0728
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Xfasm12_0728
Enzymes [BR:xfm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Xfasm12_0728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
780150..781367
Genome map
AA seq 405 aa AA seqDB search
MSDITVANYHAFPDARGHFGRYGGRFVAETLIGPLQELAQAYDAARHDPDFIAAYNKDLK
DYVGRPSPIYHAERLSRKVGGAQILLKREDLNHTGAHKINNTIGQALLAARMGKTRIIAE
TGAGQHGVASATVAARLGLECVVYMGATDIERQQINVYRMKLLGATVVPVTSGSATLKDA
LNEAMRDWVTHVGHTFYIIGTVAGPDPYPRMVRDFNAIVGREARAQMIEDYGRLPDAMTA
CVGGGSNAIGLFHAFLNDASVRIYGAEAAGDGIATGRHAASIVAGRPGVLHGNRTYVICD
DDGQILETHSVSAGLDYPGVGPEHAFLADSGRVQYVGIRDEEALAAFHLLAHTEGILAAL
ESSHAVAHAMTLARDLPKDALVLCNLSGRGDKDVHTIAAREGVRV
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatattactgttgctaactatcatgctttccctgatgctcgcggccattttggg
cgttacggtggtcgttttgttgctgaaacgttgatcggaccgttgcaggagcttgcacag
gcctatgatgcggcgcgccatgatcccgatttcatcgccgcttataacaaggatctcaag
gattatgtgggtcgccccagtccgatctaccatgctgaacggctgagccgtaaggtgggt
ggcgctcaaattctgttgaagcgtgaggatctgaatcacaccggtgcgcacaaaatcaat
aacaccattggccaggccttgctggcagcacgtatgggcaagacacgcatcattgccgag
actggagccggtcagcatggtgtcgccagtgccactgtcgctgcgcgtttgggtttggag
tgtgtggtgtatatgggggctacggatatcgagcggcagcagatcaacgtgtatcggatg
aagttgttgggtgcgacggtggtgcccgtgacttccggttcagccacactcaaggatgcg
cttaacgaagcgatgcgcgattgggtgacgcatgtggggcatacgttttatatcattggc
actgttgctggcccagatccgtatccgcgtatggtgcgcgacttcaacgcaattgttggc
cgtgaggcacgtgcgcagatgattgaagattatgggcgtttaccggatgcgatgactgct
tgtgttggcggtgggagtaatgccattggtttgttccatgccttcctcaatgatgcttcg
gtgaggatctatggtgctgaggcggctggagacggcattgcgacgggccgtcacgcggcc
tcgattgttgccggtcgtccgggggtgttgcatgggaatcgcacctacgtgatatgtgat
gatgatggacagattttggaaacccattctgtatcagccggtttggattatccgggggtt
ggtcctgagcacgcctttttggctgacagtggccgggtgcagtatgtggggattcgggat
gaagaagcgttggctgcattccacttgcttgcacatactgaaggcatcttggctgcattg
gaatccagtcacgctgtggcccatgccatgacgttggcgcgcgatcttcccaaagatgca
ttggtactgtgtaacttgtccggtcgcggtgataaggatgtgcacacgatcgcggcgcgc
gaaggtgtacgtgtctga

DBGET integrated database retrieval system