KEGG   Xylella fastidiosa M12: Xfasm12_0728Help
Entry
Xfasm12_0728      CDS       T00677                                 

Definition
(GenBank) Tryptophan synthase (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
xfm  Xylella fastidiosa M12
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xfm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Xfasm12_0728
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Xfasm12_0728
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Xfasm12_0728
Enzymes [BR:xfm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Xfasm12_0728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
780150..781367
Genome map
AA seq 405 aa AA seqDB search
MSDITVANYHAFPDARGHFGRYGGRFVAETLIGPLQELAQAYDAARHDPDFIAAYNKDLK
DYVGRPSPIYHAERLSRKVGGAQILLKREDLNHTGAHKINNTIGQALLAARMGKTRIIAE
TGAGQHGVASATVAARLGLECVVYMGATDIERQQINVYRMKLLGATVVPVTSGSATLKDA
LNEAMRDWVTHVGHTFYIIGTVAGPDPYPRMVRDFNAIVGREARAQMIEDYGRLPDAMTA
CVGGGSNAIGLFHAFLNDASVRIYGAEAAGDGIATGRHAASIVAGRPGVLHGNRTYVICD
DDGQILETHSVSAGLDYPGVGPEHAFLADSGRVQYVGIRDEEALAAFHLLAHTEGILAAL
ESSHAVAHAMTLARDLPKDALVLCNLSGRGDKDVHTIAAREGVRV
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatattactgttgctaactatcatgctttccctgatgctcgcggccattttggg
cgttacggtggtcgttttgttgctgaaacgttgatcggaccgttgcaggagcttgcacag
gcctatgatgcggcgcgccatgatcccgatttcatcgccgcttataacaaggatctcaag
gattatgtgggtcgccccagtccgatctaccatgctgaacggctgagccgtaaggtgggt
ggcgctcaaattctgttgaagcgtgaggatctgaatcacaccggtgcgcacaaaatcaat
aacaccattggccaggccttgctggcagcacgtatgggcaagacacgcatcattgccgag
actggagccggtcagcatggtgtcgccagtgccactgtcgctgcgcgtttgggtttggag
tgtgtggtgtatatgggggctacggatatcgagcggcagcagatcaacgtgtatcggatg
aagttgttgggtgcgacggtggtgcccgtgacttccggttcagccacactcaaggatgcg
cttaacgaagcgatgcgcgattgggtgacgcatgtggggcatacgttttatatcattggc
actgttgctggcccagatccgtatccgcgtatggtgcgcgacttcaacgcaattgttggc
cgtgaggcacgtgcgcagatgattgaagattatgggcgtttaccggatgcgatgactgct
tgtgttggcggtgggagtaatgccattggtttgttccatgccttcctcaatgatgcttcg
gtgaggatctatggtgctgaggcggctggagacggcattgcgacgggccgtcacgcggcc
tcgattgttgccggtcgtccgggggtgttgcatgggaatcgcacctacgtgatatgtgat
gatgatggacagattttggaaacccattctgtatcagccggtttggattatccgggggtt
ggtcctgagcacgcctttttggctgacagtggccgggtgcagtatgtggggattcgggat
gaagaagcgttggctgcattccacttgcttgcacatactgaaggcatcttggctgcattg
gaatccagtcacgctgtggcccatgccatgacgttggcgcgcgatcttcccaaagatgca
ttggtactgtgtaacttgtccggtcgcggtgataaggatgtgcacacgatcgcggcgcgc
gaaggtgtacgtgtctga

DBGET integrated database retrieval system