KEGG   Xylella fastidiosa M12: Xfasm12_0729Help
Entry
Xfasm12_0729      CDS       T00677                                 

Definition
(GenBank) Tryptophan synthase (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
xfm  Xylella fastidiosa M12
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xfm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Xfasm12_0729
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Xfasm12_0729
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Xfasm12_0729
Enzymes [BR:xfm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Xfasm12_0729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
781493..782299
Genome map
AA seq 268 aa AA seqDB search
MHRIDETFRRLRAQSRKALIPFITAGDPSLEAAVPVMHALVRAGADVIELGVPFSDPMAD
GPVIQHSSERALQRGVGLAYVLQTVDVFRQSDAVTPVVLMGYLNPLEIYGIARFTQQALA
SGVDGVLLVDLPPEEADEIRAIFSAAGLALIVLASPTTSASRLATLSGVAQGYLYYVSFA
GVTGADRLDAQSAGDRLRGLRAQTQVPVVVGFGIRDAASAVVMAVDADGVVVGSALVTAL
SDAPDVDTACRRADAFLAPLRQALDAVK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgtatagacgaaacattccgccgtttaagggcgcaatcgcgtaaggcgttgatc
cctttcatcactgctggcgacccctctttggaggcggctgttccggtgatgcatgctttg
gtccgtgcgggggcggatgtgattgagttgggtgtgccgttttcggacccgatggcggat
ggtccggtgattcagcacagttccgagcgcgcgttgcagcgtggtgtgggtttggcctat
gtgttgcagacagtcgatgtgttccgtcagagtgatgcagtgacgccggtggtcttgatg
ggctacctcaatcctttggaaatctatggcattgcgcgttttacacagcaggcactggct
tctggagtggatggggtgctgcttgtggatcttcctccggaagaggcggacgagatccgc
gcgatcttttcggcggctggtttggcactcatcgttttggcatctccgacgacctctgcc
tcccgtctggccacgttgagtggggttgcccaggggtacttgtattacgtgagttttgct
ggcgtgactggtgctgatcggcttgatgcgcagtcagccggtgatcgcttgcgtggatta
cgtgcgcagactcaagtcccggtggtggttggctttggtatcagggatgcggccagtgct
gtggtgatggcggtggatgcggatggggtggtggttggcagtgccttggtgacggcctta
agtgatgctccggatgtggacaccgcctgccggcgtgctgatgcgtttttggcaccgttg
cgtcaggcgttggatgcggtgaagtag

DBGET integrated database retrieval system