KEGG   Xylella fastidiosa M12: Xfasm12_0729Help
Entry
Xfasm12_0729      CDS       T00677                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
xfm  Xylella fastidiosa M12
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:xfm01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:xfm00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:xfm00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
781493..782299
Genome map
AA seq 268 aa AA seqDB search
MHRIDETFRRLRAQSRKALIPFITAGDPSLEAAVPVMHALVRAGADVIELGVPFSDPMAD
GPVIQHSSERALQRGVGLAYVLQTVDVFRQSDAVTPVVLMGYLNPLEIYGIARFTQQALA
SGVDGVLLVDLPPEEADEIRAIFSAAGLALIVLASPTTSASRLATLSGVAQGYLYYVSFA
GVTGADRLDAQSAGDRLRGLRAQTQVPVVVGFGIRDAASAVVMAVDADGVVVGSALVTAL
SDAPDVDTACRRADAFLAPLRQALDAVK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgtatagacgaaacattccgccgtttaagggcgcaatcgcgtaaggcgttgatc
cctttcatcactgctggcgacccctctttggaggcggctgttccggtgatgcatgctttg
gtccgtgcgggggcggatgtgattgagttgggtgtgccgttttcggacccgatggcggat
ggtccggtgattcagcacagttccgagcgcgcgttgcagcgtggtgtgggtttggcctat
gtgttgcagacagtcgatgtgttccgtcagagtgatgcagtgacgccggtggtcttgatg
ggctacctcaatcctttggaaatctatggcattgcgcgttttacacagcaggcactggct
tctggagtggatggggtgctgcttgtggatcttcctccggaagaggcggacgagatccgc
gcgatcttttcggcggctggtttggcactcatcgttttggcatctccgacgacctctgcc
tcccgtctggccacgttgagtggggttgcccaggggtacttgtattacgtgagttttgct
ggcgtgactggtgctgatcggcttgatgcgcagtcagccggtgatcgcttgcgtggatta
cgtgcgcagactcaagtcccggtggtggttggctttggtatcagggatgcggccagtgct
gtggtgatggcggtggatgcggatggggtggtggttggcagtgccttggtgacggcctta
agtgatgctccggatgtggacaccgcctgccggcgtgctgatgcgtttttggcaccgttg
cgtcaggcgttggatgcggtgaagtag

DBGET integrated database retrieval system