KEGG   Xylella fastidiosa M12: Xfasm12_0729Help
Entry
Xfasm12_0729      CDS       T00677                                 

Definition
(GenBank) Tryptophan synthase
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
xfm  Xylella fastidiosa M12
Pathway
xfm00260  Glycine, serine and threonine metabolism
xfm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xfm01100  Metabolic pathways
xfm01110  Biosynthesis of secondary metabolites
xfm01130  Biosynthesis of antibiotics
xfm01230  Biosynthesis of amino acids
Module
xfm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xfm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Xfasm12_0729
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Xfasm12_0729
Enzymes [BR:xfm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Xfasm12_0729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA Peripla_BP_6 His_biosynth DUF561 ThiG TMP-TENI PcrB AIRS_C
Motif
Other DBs
NCBI-ProteinID: ACA11723
JGI: Xfasm120729
UniProt: B0U6K7
Position
781493..782299
Genome map
AA seq 268 aa AA seqDB search
MHRIDETFRRLRAQSRKALIPFITAGDPSLEAAVPVMHALVRAGADVIELGVPFSDPMAD
GPVIQHSSERALQRGVGLAYVLQTVDVFRQSDAVTPVVLMGYLNPLEIYGIARFTQQALA
SGVDGVLLVDLPPEEADEIRAIFSAAGLALIVLASPTTSASRLATLSGVAQGYLYYVSFA
GVTGADRLDAQSAGDRLRGLRAQTQVPVVVGFGIRDAASAVVMAVDADGVVVGSALVTAL
SDAPDVDTACRRADAFLAPLRQALDAVK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgtatagacgaaacattccgccgtttaagggcgcaatcgcgtaaggcgttgatc
cctttcatcactgctggcgacccctctttggaggcggctgttccggtgatgcatgctttg
gtccgtgcgggggcggatgtgattgagttgggtgtgccgttttcggacccgatggcggat
ggtccggtgattcagcacagttccgagcgcgcgttgcagcgtggtgtgggtttggcctat
gtgttgcagacagtcgatgtgttccgtcagagtgatgcagtgacgccggtggtcttgatg
ggctacctcaatcctttggaaatctatggcattgcgcgttttacacagcaggcactggct
tctggagtggatggggtgctgcttgtggatcttcctccggaagaggcggacgagatccgc
gcgatcttttcggcggctggtttggcactcatcgttttggcatctccgacgacctctgcc
tcccgtctggccacgttgagtggggttgcccaggggtacttgtattacgtgagttttgct
ggcgtgactggtgctgatcggcttgatgcgcagtcagccggtgatcgcttgcgtggatta
cgtgcgcagactcaagtcccggtggtggttggctttggtatcagggatgcggccagtgct
gtggtgatggcggtggatgcggatggggtggtggttggcagtgccttggtgacggcctta
agtgatgctccggatgtggacaccgcctgccggcgtgctgatgcgtttttggcaccgttg
cgtcaggcgttggatgcggtgaagtag

DBGET integrated database retrieval system