KEGG   Xylella fastidiosa M12: Xfasm12_0763Help
Entry
Xfasm12_0763      CDS       T00677                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
xfm  Xylella fastidiosa M12
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xfm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Xfasm12_0763
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Xfasm12_0763
Enzymes [BR:xfm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Xfasm12_0763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
819387..820664
Genome map
AA seq 425 aa AA seqDB search
MSKIVVAGGTPLYGDVRISGAKNAVLPILCATLLADAPVEISNVPYLHDVITMINLLREL
GAGVTMNEGIEAKGRSITVDPRWVRQRVVPYDLVKTMRASVLLLGPLLACYGAAEVALPG
GCAIGSRPVDQHIRGLQSLGAEITVENGYIKASVSQGRLKGGRFVFDVVSVTGTENLLMA
AAVAQGTSVIENAAMEPEVVDLAECLITLGARVEGAGTPRIVVEGVERLKSGQYAVLPDR
IETGTFLVATAMTGGRISMQQVRPQTLDAVLGKLTEAGACIEIGADSIRLDMQGRRPCSV
NLTTAPYPGFPTDMQAQFMALNCVAEGVGVIKETIFENRFMHVDELLRLGAKIQIEGHTA
IVQGVERLSGAPVMATDLRASASLILAGLVAEGETIIDRIYHLDRGYENIEKKLGVLGAS
IRRMT
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaattgtagttgctggtggtaccccgctatatggggatgttcggatttccggt
gccaagaatgctgtccttcctattttatgtgccacgttgctcgctgatgcgccggtggag
atcagcaacgtaccctatctgcatgacgtgatcaccatgatcaatttgcttcgtgaattg
ggtgcgggtgtcaccatgaatgaaggcattgaggcgaaaggacgttcgattacggttgat
ccgcgctgggtacgtcagcgcgtggtgccgtatgatttggtgaagaccatgcgtgcttct
gtgttgctgttgggtccgttattggcctgctatggtgccgctgaagttgcacttcctggg
gggtgtgcgattggttcacgtccggtcgaccagcacatcagaggattgcaatcacttggt
gcggagatcacggttgagaatggttacatcaaggcttctgtcagtcagggtcgattgaag
ggaggtcgtttcgtgttcgacgtggtgagtgtgacaggcactgagaacctgttgatggct
gcagctgtggctcaggggacgagcgtcattgagaatgctgcgatggagccggaggttgtc
gatttagccgagtgtttgatcactctcggtgcgcgtgttgagggtgctggtaccccacgt
atcgtggtcgaaggggtggaaaggttaaagagcgggcagtatgcagtgttacctgaccgc
attgagacgggtacttttttggtggctacagcgatgacgggggggcggattagtatgcag
caggtgcgcccgcagactctggatgcggtgctgggcaaactgaccgaggccggagcgtgc
atcgaaataggtgcagatagtatccgtttggatatgcaggggcggcgcccatgttctgtt
aatctgacaactgcaccttaccctgggtttcccactgacatgcaggctcagtttatggcg
ctgaattgtgttgcagaaggcgtcggtgtgatcaaagaaacgatcttcgagaaccgtttc
atgcacgttgatgaactgttacggctcggcgccaaaattcagattgagggccataccgcg
attgtgcagggtgtcgagcgattgagcggtgcaccggtgatggcgactgaccttcgcgcc
tcggcctcattgattctggctggtttggtcgcggagggggaaacaatcattgatcgcatt
taccacctggatcgtggttacgaaaacattgagaaaaaactcggagtgctgggtgcatca
atccggcgtatgacatga

DBGET integrated database retrieval system