KEGG   Xylella fastidiosa M12: Xfasm12_0771Help
Entry
Xfasm12_0771      CDS       T00677                                 

Definition
chitinase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
xfm  Xylella fastidiosa M12
Brite
Enzymes [BR:xfm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Xfasm12_0771
Secretion system [BR:xfm02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Xfasm12_0771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(827669..828457)
Genome map
AA seq 262 aa AA seqDB search
MYRLIAALLLGIVTLTACAQPSQPSSNKTSTTPTNATPANVQQRVTAALNTLDPDFKPDY
IGAAPFPGFREVVVSGQILYVSDNGRYLIQAQPYDIQNKKFAVSEGLLSYRRTQLATVPQ
SQRIVFAPKNPQYTISVFTDIECGYCRKLHSEIAELNKQGIAVEYLAFPRMGLGSQDYKD
MVSVWCATDRKQALTEAKAGKQIQNKNCNNPVALEYSLGQRIGVNGTPAIFAPDGTQLGG
YLPPEKLRALLDKLAAATAKGG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgccttatcgccgccttgttgctgggtatcgtgaccctcaccgcctgcgcacaa
ccctcacaacccagctccaacaaaacgagcaccacaccaaccaacgccacgccagccaac
gtgcaacaacgcgtgactgccgccctaaacactctggacccagatttcaagccagactac
atcggtgccgcaccattcccgggtttccgtgaagttgtggtcagcggccaaattctgtat
gtcagcgacaacggccgctacctcattcaggcacaaccctacgacattcaaaacaaaaaa
tttgctgtcagcgaagggctgctttcctaccgccgcacccaactggccacagtgccccaa
tcgcaacgcatcgtgttcgcaccaaagaacccccaatacaccatcagcgtattcaccgac
attgaatgcggctattgccggaaactacatagcgaaatcgccgaactgaataaacaaggc
atcgccgttgaatacctcgccttcccacggatgggtttaggaagccaagattacaaagac
atggtctcagtgtggtgcgccactgatcgtaaacaagcactgaccgaagcaaaagccggc
aaacaaatccagaataaaaattgtaataaccctgttgccttggaatacagcctaggtcaa
cgtatcggcgtcaacggcaccccagcaatcttcgccccagacggcacccagcttggcggc
tatctaccaccagaaaaactacgtgcactgctggacaaactcgccgccgccacagctaaa
gggggctga

DBGET integrated database retrieval system