KEGG   Xylella fastidiosa M12: Xfasm12_0799Help
Entry
Xfasm12_0799      CDS       T00677                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
xfm  Xylella fastidiosa M12
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xfm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Xfasm12_0799
Enzymes [BR:xfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Xfasm12_0799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
858814..859443
Genome map
AA seq 209 aa AA seqDB search
MGGVFDRTLSVQHEGSNNAAFMPMTEVDVVSGCMREYGMTSVLLSLGSNVRPRYYLRQAE
AALHAFFGEVLFSPVYRTLAVGFDGPDFLNSAAMVHTAMSLSDLHAWLHALEERYGRDRA
VPRFGNRTLDVDVVFYGDLIVKEPGGEYCIPRRELKHSFVLKPLVDVAPDFVDPVSGRTL
AQLWAVHPHVDACFQVVDLEVPGDDRDMI
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
gtgggcggagtttttgacagaacacttagtgtgcagcacgagggcagcaataacgctgca
ttcatgcccatgacggaggttgacgttgtctctggttgcatgcgcgaatatggcatgact
agtgtgcttctgagtttaggtagtaatgtgcgtcccaggtattacttgcgtcaggcagaa
gctgcactgcacgctttttttggtgaagtgttgttttctcctgtctaccgcactttggct
gtgggttttgacggtccggatttccttaatagtgctgccatggtgcataccgctatgtct
ctgtcagatttgcatgcatggttgcatgcgttggaggaacgctatggccgtgatcgcgcc
gtgccgcgttttggtaaccgtacgctggatgtggatgtggtgttctatggtgatctgatc
gtgaaagaaccaggtggggaatactgtattccacgtcgtgagttgaagcatagttttgtg
cttaaaccattagtggatgtggcaccggattttgtcgatccagtcagtgggcgtaccttg
gcgcagttgtgggcggtgcatccacacgtcgacgcatgtttccaggtcgtggatcttgaa
gtacccggtgacgatagagacatgatttag

DBGET integrated database retrieval system