KEGG   Xylella fastidiosa M12: Xfasm12_0912Help
Entry
Xfasm12_0912      CDS       T00677                                 

Definition
lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
xfm  Xylella fastidiosa M12
Brite
Enzymes [BR:xfm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Xfasm12_0912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(986585..987079)
Genome map
AA seq 164 aa AA seqDB search
MQTIGEEGIALIKFFEGCKLSSYTCPGGVLTIGYGETGNHVVPGLRLTNEQEADAMLRAR
LAKEFEPAVRRYVRVPLKQHQFDALVSLSFNIGAGAFHRSTLLRKLNAGDVAGAAQQFHV
WKWAGGRVQSGLIIRRAAERALFEGSDWRAEEKQRRAALKGRRD
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccattggtgaagaaggcattgcactcatcaagttttttgagggttgcaagctg
agctcgtatacctgtcctgggggtgtgttgacgattggttacggcgagacgggcaatcac
gttgtaccagggttgcggcttaccaatgagcaggaagcggatgcgatgttacgtgctcga
ttagccaaagagtttgaaccggctgtaaggcgttatgtgcgtgtgccactcaagcaacat
caatttgatgcgttggtatcgctgagcttcaacattggtgcgggcgcgttccaccgctcg
acgctgttacgcaagcttaatgccggtgatgttgctggtgcggcgcagcagtttcatgtg
tggaaatgggcgggcggtcgtgtgcagtctggcttaatcatcaggcgtgccgccgaacgt
gcattgtttgaaggcagtgactggcgtgctgaagagaagcaacggcgtgccgctttaaag
ggtcgccgtgattga

DBGET integrated database retrieval system