KEGG   Xylella fastidiosa M12: Xfasm12_0949Help
Entry
Xfasm12_0949      CDS       T00677                                 

Definition
putative beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
xfm  Xylella fastidiosa M12
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:xfm00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:xfm00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1027579..1029645
Genome map
AA seq 688 aa AA seqDB search
MSSVRPHWKLVVVALLVTSGFITIQGASAETSTRNLAASGETATRASDLGTPPSVEHATE
NGKTYSHLVSTRIAASSSESMFGMSGAHKASINIKEKVKAMTLEEKIGQKIMLDFRSWDP
KQDMTEPDGVIGQLISNNHIGGVILFSNNLKERSQIKKLTAWYAGMENSGGVRLLIATDN
EGGNVFRLPRSEYASFPGNMALAAAIEGGANEQLAFEQGRLLAHDMLALKINTTFAPVAD
VNTNPFNPVINVRAFSDSANVVSFLAGKIAGGMEQQGMITTYKHFPGHGSTSTDSHTGLP
RVDLSQEDALEIDIAPYIQAIADNAAPDMIMTAHIQYPALDDSLVTNRNGQKIIVPATMS
HKIQTHILRDKLGYEGVTISDALDMGAITDNFDQEDSIERVFAAGVDIALMPISISSPSQ
AYLLPHLISLVVEAVRGGRINEDDIDASVERILELKARHNLLKGYGIKLTRAPSLSALSA
KKVQKTIADQSITVVINSQSLLPLKNKLLRYFVLTPQAQQARGIAAVMAQEGYLHVVAAE
EAGLNDAQIRENIAKCDIFLLGTLPTSFTAVEWDIVPAALATVVQNNNNYPDWLKYAASL
GKKRVHLSMRAPYDIVNYSEYVDAAVAVYSYFGYNNGVWLGPSIRSLAEVLTGKLPPRGK
LPVNLWRNYDVKTNTGTVAFPRGFGLSW
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtccgaccccactggaaattggttgtggttgctctacttgtgacgtctggc
tttatcacgatacaaggcgcttccgcagaaaccagcaccagaaacctcgctgcgagcggc
gagacagcaacgcgtgcatccgatctaggtacgccgccctctgttgaacatgctacggaa
aacggtaaaacgtattctcacctggttagtacaagaatcgccgcaagctccagcgagagt
atgtttggcatgagtggagcgcataaggctagcataaatataaaagaaaaagtaaaggca
atgactcttgaggagaaaatcggacaaaaaataatgcttgattttcgctcttgggatcca
aagcaggacatgacagagcctgatggagtaattggacagttgatttcaaacaaccatatt
ggtggcgtcattcttttttccaataatcttaaggagcggtctcagatcaagaagcttaca
gcttggtatgcagggatggagaacagcggaggcgtgcgtttgctgattgccacggacaac
gaaggaggtaatgtcttccgacttccacgcagcgagtatgcttcctttccaggcaatatg
gcgctggctgcggccattgaaggaggcgcaaacgaacagctcgcctttgaacaaggcagg
ctgttggctcatgatatgcttgccttgaagataaataccacttttgctccggtggccgat
gtcaacaccaacccctttaaccctgtgatcaatgttcgcgcattcagtgacagcgcgaat
gtcgtttctttcttggccgggaaaattgcaggtggaatggagcaacaggggatgatcact
acctataagcatttcccgggacatggcagcacctccaccgattcacacactggccttcct
cgcgtggatctttcgcaggaagatgccttagaaattgatattgcgccttatatacaggcc
atcgccgacaatgctgctccagacatgatcatgacggcgcatatccagtacccggcgctg
gatgatagcttggtaaccaatcgtaatggccaaaagattatagtgccggcaaccatgtcg
cataagatacaaacgcatatcttgcgcgacaaactaggttatgaaggcgtgaccatctcg
gatgcactggacatgggggcaattacggacaacttcgaccaagaagattctatcgagagg
gtatttgctgccggagtggatatcgcgctgatgcccatcagtatctcttcaccttctcaa
gcctatcttctgccacacctgatcagtctggttgtcgaagcggttagaggaggacgcatt
aatgaagatgatatagatgcctcggtcgaacggattttggaactcaaggcacggcataac
ctgctgaaaggatatggaataaaattgacaagggcaccctcattatcggctttatcagcg
aaaaaagttcaaaagactatcgccgatcagtctataaccgtggtgatcaacagccagtct
ctgttgccgttaaaaaataaattactacgctatttcgtcctgacgcctcaagcgcagcag
gccagaggcatcgcagccgtgatggcgcaagaaggataccttcacgtggttgccgcagaa
gaagcaggactcaatgatgcgcagataagagaaaatattgccaaatgcgacatttttctg
ctcgggacactgccgacaagctttacagcagttgagtgggatatcgttcctgccgcgcta
gcgacagtggtgcagaacaacaacaattatcccgattggctcaagtatgctgccagcttg
gggaaaaaacgtgtccacctctcgatgcgtgcaccatacgatatcgtcaactattccgaa
tacgtggatgcagctgtcgccgtttattcttattttgggtataacaacggagtctggctc
ggcccttccataaggtccctagcggaagtccttactggcaaattgcccccccgtggaaaa
ctgccggtaaatctttggcgcaattacgatgtgaagacaaatactggaacagtggccttt
ccgcgaggattcgggctgagctggtga

DBGET integrated database retrieval system