KEGG   Xylella fastidiosa M12: Xfasm12_0990Help
Entry
Xfasm12_0990      CDS       T00677                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
xfm  Xylella fastidiosa M12
Pathway
xfm00790  Folate biosynthesis
xfm01100  Metabolic pathways
Module
xfm_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xfm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Xfasm12_0990
Enzymes [BR:xfm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Xfasm12_0990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ACA11960
JGI: Xfasm120990
UniProt: B0U794
Position
complement(1067123..1067734)
Genome map
AA seq 203 aa AA seqDB search
MDHSKQQNASITQAQAEEAVRTLLRWAGEDPTREGLLDTPRRVVEAYGDWFSGYREDPHD
YLQRTFEEISGYDEMIVLRNITYESHCEHHMAPIIGKVHVGYLPNGKVVGISKLARVVES
YARRFQIQEKMTAQIAACIQETLSPRGVGVVIEGAHACMTTRGIHKRGVSMVTSKMLGTF
REDARTRAEFLQFIEVGTNVMDL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggaccattccaaacaacaaaacgcatccatcacccaagcccaggcagaagaagccgta
cgcacacttctacgttgggccggcgaagatcccactcgtgaaggcttactcgacacacca
cgccgtgtcgttgaagcatacggagattggttcagcggttaccgcgaagatcctcatgac
tacctgcaacgcactttcgaggaaatctctggctacgacgagatgatcgtactacgtaac
attacctatgaaagccactgcgaacatcacatggcacccatcatcggtaaagttcacgtt
ggctacttgccaaacggcaaagtcgtcggcatcagcaaattagcacgcgttgttgaatcc
tatgcgcgccgcttccagatacaggaaaagatgactgcgcagattgcagcatgtattcaa
gagacattaagcccacgtggcgtcggtgtcgtgattgaaggtgcacacgcatgtatgact
acccgaggcatacacaagcgtggtgtatcaatggtcacctcaaagatgctcggtaccttc
cgtgaagacgcacgcactcgcgccgagttcttacagttcatcgaagtaggtaccaacgtg
atggacttatga

DBGET integrated database retrieval system