KEGG   Xylella fastidiosa M12: Xfasm12_1061Help
Entry
Xfasm12_1061      CDS       T00677                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
xfm  Xylella fastidiosa M12
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:xfm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Xfasm12_1061 (ruvA)
Enzymes [BR:xfm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Xfasm12_1061 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1146867..1147451
Genome map
AA seq 194 aa AA seqDB search
MIGRLRGVLTSKTPPWLVVDVCGVGYELEVPMSTFCELPDVGYEVNLFTHYTQKDDSAAL
YGFLSESERRLFRHLQRVSGIGTKIALAVLSSVSVDTFAGLIQAGDVNALTVIPGIGKKT
AERMLVELRDRAADFNNGISTSGKLNLDTVSEAALALQQLGYKPAEAARMARDAGTESDD
VATVIKKALQAALC
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgattggtcgcttgcgaggggttttgactagcaaaacgccaccgtggctcgtggttgat
gtgtgtggagttggctacgaactagaggtgccgatgagcactttttgcgaattgccagac
gtcggttacgaggtgaatttgtttactcactatacgcagaaggatgatagtgccgcgttg
tacggttttctgagcgaaagtgagcggcggctattccgccacctgcagcgggtgagtggt
atcggtaccaagatcgctttggcggttctatccagcgtcagcgtggatacatttgctggg
ttaatccaggctggtgacgttaatgcattaacggttatcccaggaattgggaagaaaacc
gctgaacgtatgctggtggagttgagagaccgtgctgcagacttcaacaatggtatttcc
acctcaggcaagctcaatcttgatacggtgtctgaagctgccttggctttgcagcaactc
ggttataagccagctgaggctgcacgtatggcacgtgatgctggtactgagagcgatgat
gttgctactgtcatcaaaaaagcgcttcaagccgcgttatgttga

DBGET integrated database retrieval system