KEGG   Xylella fastidiosa M12: Xfasm12_1072Help
Entry
Xfasm12_1072      CDS       T00677                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
xfm  Xylella fastidiosa M12
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xfm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Xfasm12_1072 (gpmA)
   01230 Biosynthesis of amino acids
    Xfasm12_1072 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Xfasm12_1072 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Xfasm12_1072 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Xfasm12_1072 (gpmA)
Enzymes [BR:xfm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Xfasm12_1072 (gpmA)
Exosome [BR:xfm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Xfasm12_1072 (gpmA)
  Exosomal proteins of melanoma cells
   Xfasm12_1072 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1157166..1157915)
Genome map
AA seq 249 aa AA seqDB search
MTRKLVLLRHGQSQWNSMNRFTGWVDIGLTEQGHQEATMAGHLMKEEGLEFDVAHTSLLK
RAIHTLQDALKALDQDWLPIYKSWRLNERHYGALQGLDKIDTAAKHGEEQVNIWRRSYDI
QPPPIDLDDPSHPMRDRRYAALDRKVLPVTESLKNTLERVLPYWNDAIAPQLNDNKTVLI
SAHGNSLRALYKYLNQESDEKILNVNIPTGIPLLFELSDTLQVVSYRYLGDPDAAQRAAE
MVANQGKAK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtaaacttgtattgctacgccatggacagagtcaatggaactcaatgaaccgt
tttactggctgggtggatatagggctgaccgaacaaggtcatcaagaagccactatggct
ggtcatctgatgaaagaagaaggactagagtttgatgtcgctcatacttctttacttaag
cgggcgatccatacattacaagacgcacttaaagcattggaccaggactggttaccaatt
tataaaagctggcgtctcaatgagcgtcactacggtgctctacaaggccttgataaaata
gataccgcagctaaacatggtgaagagcaagtcaatatttggcgccgatcctatgacatc
cagccgccgccgattgatctagatgacccaagccatccaatgcgagaccgccgttacgct
gctctggaccgcaaagtattacctgtgacggaatcgctgaaaaacacactcgaacgagta
ttaccgtactggaatgatgctatcgcaccacaactaaatgacaacaagacggtacttatt
agcgcccacggcaactcattgcgtgcgttgtacaagtaccttaatcaagaaagtgatgag
aaaatcctaaatgtcaatatccctactggcattccacttctatttgaactgagcgataca
ctacaagtagtgagttaccgttaccttggcgatccagatgcagcacaacgcgctgccgaa
atggtagcaaaccaaggtaaggcgaaataa

DBGET integrated database retrieval system