KEGG   Xylella fastidiosa M12: Xfasm12_1075Help
Entry
Xfasm12_1075      CDS       T00677                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
xfm  Xylella fastidiosa M12
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:xfm00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Xfasm12_1075
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Xfasm12_1075
Enzymes [BR:xfm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Xfasm12_1075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1160797..1161303
Genome map
AA seq 168 aa AA seqDB search
MTSIYTFTFTRLDGRPQALADWRGQVLLLVNVASHCGFTPQYAGLEMLWQRYRDAGLIVI
GFPCDQFAGQEPGDEAKIAEFCTLTYGVDFPMAAKIKVNGADAHPLWQWLKHRRRGLFGV
AAIKWNFTKFLIGRNGQPIARYSPIKSPEQLEVHIVRALGEEGGGNTH
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcatctacacattcactttcacacgtcttgacggacggcctcaagcattagca
gattggcgtggacaagtactgttattggtcaacgttgcgtcgcattgcggctttactcca
caatatgctgggttggagatgctatggcaacgttaccgcgatgcaggtttgattgttatt
ggctttccatgcgatcaattcgctgggcaggaacctggggatgaggccaaaattgctgag
ttttgcacgctgacctatggggtggatttcccaatggcggcgaagatcaaagtcaatgga
gcagatgcacatccactgtggcaatggctcaagcaccgccgccgtggtttgttcggtgtg
gccgcgattaagtggaacttcactaaatttctgatcggacgcaacgggcaacccattgcc
cgttattcgccaatcaagtcaccggagcaattggaggtgcatatcgttcgtgccttaggg
gaggaagggggagggaatactcattga

DBGET integrated database retrieval system