KEGG   Xylella fastidiosa M12: Xfasm12_1215Help
Entry
Xfasm12_1215      CDS       T00677                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
xfm  Xylella fastidiosa M12
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:xfm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Xfasm12_1215 (recR)
DNA repair and recombination proteins [BR:xfm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Xfasm12_1215 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1282068..1282664)
Genome map
AA seq 198 aa AA seqDB search
MSTHLLEQLIDAFRILPGVGQKTAQRMAYHVLEREREGGQRLADVLSRAIEKIGHCTECR
DFSETKICAICANSSRDRHQLCVVESPPDRLAIEQATGYRGLYFILQGRLSPLDGIGPHE
LGLDHLGQRLAAGEVTELIIATNATVEGETTAHYLALLARQHGIRPSRLAQGLPLGGELE
YLDRGTLSHAFGTRTEVV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgagtacacatttgcttgagcagttaattgacgccttccgtatcttgccaggtgtcggt
cagaagaccgcgcagcgtatggcctaccatgtgctcgagcgcgagcgtgaaggtggacag
cgcttggctgatgtgctgagccgtgcgattgagaaaattggtcattgtacggagtgtcgt
gacttcagtgagaccaaaatctgtgcgatctgcgctaactccagccgtgaccgtcatcag
ttgtgcgtggtcgagtccccccctgatcggctggcgattgagcaagccactggctaccgt
ggactatattttattttgcaggggcgcctgtccccgctggatgggatcggccctcatgaa
cttgggttggaccatttaggacaacgtcttgctgcaggtgaggtgacggagctcatcatt
gcgactaatgcgacggtggagggtgagacgacagcgcactacttagcgctcctggcgcgc
caacacggtatacgccccagccgactggcacaaggtttgcccttgggtggggagctggaa
tacttagaccgcggcactctttcgcacgcgttcggcacccgtactgaagtggtctga

  All links  
No link information was found.   
DBGET integrated database retrieval system