KEGG   Xylella fastidiosa M12: Xfasm12_1226Help
Entry
Xfasm12_1226      CDS       T00677                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
xfm  Xylella fastidiosa M12
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xfm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Xfasm12_1226
Enzymes [BR:xfm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Xfasm12_1226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1291310..1292092
Genome map
AA seq 260 aa AA seqDB search
MHTMTRPDQARTPWYLLSLRPANNHAALRRAVARYGGGLIALSPWRLKRLDSPETRSALA
SALTASTLVFTSPEAVRAAHALQTLRTSPRQVWLCVGASTARVLQQCGITRVLHPTQMNS
EGLLTLLAQQPPTEVGLITAPGGRDLLQQKLLENSIRLHRADVYERQPLRLRTATLDALQ
RNATRSLLALSSAEALALLLPQWPDNLRRILYQRPVIATSKRLEDLACARGFISVYRATG
PLPRQLAATAAAFRPDKTAQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcacaccatgacaagaccagaccaagcccgcaccccatggtatttgttgtcactacgt
ccggcaaacaaccacgccgcactgcgccgtgccgtcgcacgttacggaggaggattaatc
gcactatccccgtggcgattaaagcgtctagacagtccagagacacgctctgcattagca
tcagcattgacggcatcaaccctggttttcaccagtccagaggcagtacgtgcagcacat
gctctgcaaacgctacgcacttcacctagacaagtatggttgtgcgttggcgcaagcact
gcacgcgtgctacaacagtgcggcattacacgcgtgttgcacccaacacaaatgaacagt
gaagggctactcacattactggcacagcaacccccaaccgaagttggacttattaccgca
ccaggaggacgtgatttactccagcagaagcttttagaaaatagcatacggttacatcgt
gccgatgtctacgaacgtcaaccgttacgtctgcgcacagccacattggatgcactccag
cgtaatgccacacgtagcctgcttgcactgagcagtgccgaagctttagcactcttactg
ccacaatggccggataacctacgaaggatcctgtaccagcgtccagtgattgcaacaagc
aaacggctagaagatctagcatgcgcgcgaggatttataagcgtttatcgcgccacagga
ccattgccgcgccagttagcagcaacagcagcggcttttcgacccgacaaaacagcacaa
tga

DBGET integrated database retrieval system