KEGG   Xylella fastidiosa M12: Xfasm12_1411Help
Entry
Xfasm12_1411      CDS       T00677                                 

Definition
methionine salvage pathway enzyme
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
xfm  Xylella fastidiosa M12
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:xfm00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1469713..1470279
Genome map
AA seq 188 aa AA seqDB search
MSRLRIFDDHTPNTPFFVSKEQAQITAELHKIGITFERWEATQAIEPGATAEQVMAAYRA
DIDRLIATHGFKTVDVISIAPDNAKREEMRAKFLEEHFHKEDEVRFFVAGSGLFTVHSGN
KVYEIECVKNDLIAIPDGTLHWFDMGAAPYFVAIRFFTEPDGWVGHFTGTDIAQRFPRYI
PEGCQSAH
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgagccgactacgcatcttcgacgatcacacccccaatacgccgttcttcgtcagcaag
gagcaggcacagatcaccgccgagttgcacaagattggcatcacgttcgagcgctgggaa
gcgactcaagcgattgaacctggtgcaactgcagagcaggtcatggcggcctaccgcgct
gacattgatcggctgatcgccacacatggtttcaaaaccgtagacgtgatcagcatcgct
ccagacaatgccaagcgcgaagagatgcgcgccaaatttcttgaggaacattttcacaag
gaagatgaagtccgtttcttcgttgctggttctggattattcaccgtgcacagcggcaac
aaagtctatgaaatcgaatgcgttaaaaacgatctgatcgcaatacccgatggcaccctg
cactggtttgatatgggtgccgcgccgtacttcgtcgctatccgcttttttaccgaaccg
gatggctgggttggccatttcaccggcactgacattgcacaacgattcccccgctatatc
cccgagggctgccaaagcgcgcactga

DBGET integrated database retrieval system