KEGG   Xylella fastidiosa M12: Xfasm12_1423Help
Entry
Xfasm12_1423      CDS       T00677                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
xfm  Xylella fastidiosa M12
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:xfm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Xfasm12_1423
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Xfasm12_1423
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Xfasm12_1423
Enzymes [BR:xfm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Xfasm12_1423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1481294..1482595)
Genome map
AA seq 433 aa AA seqDB search
MIQMNFHSTRTTAPVTTLSQAIAAGLAPDGGLYVPECLPPLGDLDHSADLINTATALLTP
FFAGDPLEVHVPSICAEALDLPAPLLPLATPEDYVLELFHGPTAAFKDFGARFLAACLTR
LRRDAERPLTILVATSGDTGAAVAAAFHRQPGLRVVVLYPDGRVSPRQAHQLGCFGDNVH
TLRVAGVFDDCQAMVKQALNDTSLQTAVPLSSANSISLGRLLPQMSYYAHAALTHRASTG
RPLNLIVPTGNLGNALAAILARALGVPLGQIVLATNANRVLSDYFSGAHYRPQPSVATLA
NAMDVGAPSNFERLRWLYRGDDAALRAAFTAYSVDDIAIRQTITARHRRYDEIFCPHTAT
AVFVLEHLRAQGVAGDWAVVATAHPAKFEQVVEPLIGTTVPVPAALDSLLQRPASDEPLA
PEYPALRHMMLAT
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaatgaacttccattccacccgcaccacagctccggtgaccaccctcagccag
gcaatcgctgcaggcttagcaccggatggcggcttatatgtccccgagtgcttgccaccc
cttggtgacttggaccacagcgcagatttaatcaacaccgccaccgcactactgaccccc
ttctttgcgggggatccgctagaagtgcatgtgccgtcgatctgtgccgaagcgctggat
ctccccgcaccactgctgcccttggctacccctgaagattatgtccttgagttatttcac
ggccccactgctgccttcaaggattttggcgcacgttttctagcggcctgcctgactcgg
ctacgacgtgatgccgaacgtcccttgacgattctggtggctacctccggtgatacgggt
gctgcggtggcggcggcatttcatcggcaacccggattgcgtgtcgtcgttctgtacccg
gatggccgtgtatcgccacgtcaggcccaccaattgggttgttttggcgacaacgtacac
acactgcgtgtggctggcgtgttcgatgactgccaagccatggtcaagcaggcactgaac
gataccagcctccaaacagccgtgccgctgagttcggccaacagcatcagcctgggccgc
ttgctgccgcagatgagctactacgcccatgcagccttgacccaccgtgccagcacgggc
cgccctctgaacctcattgtgcccaccggcaacctcggcaatgccttggccgcgattctg
gcgcgcgccctgggagtgcccttaggacagattgtgttggcgacaaacgccaaccgcgta
ctctctgattacttttccggagcacattaccgtccccagcccagtgtggcgactttggcc
aatgcaatggacgttggagcgcccagtaatttcgaacgattgcgctggttgtatcgcggc
gatgacgctgcattgcgcgccgcctttaccgcctattccgtcgacgacatcgcgatccgc
cagaccatcaccgcacggcatcgtcgctacgacgagatattttgtccccataccgctact
gcggtgtttgtgcttgagcacttgcgtgcacagggcgtcgctggtgattgggcagttgtg
gcgaccgcgcatccagccaaatttgagcaggtggtagaaccgttgatcggtaccaccgtg
cccgtgccggcggccctggatagcctcttgcaacgtcccgcgagcgacgaaccgctcgcc
ccagagtacccggcattgcggcacatgatgctggccacctaa

DBGET integrated database retrieval system