KEGG   Xylella fastidiosa M12: Xfasm12_1451Help
Entry
Xfasm12_1451      CDS       T00677                                 

Definition
(GenBank) acetyl coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
xfm  Xylella fastidiosa M12
Pathway
xfm00010  Glycolysis / Gluconeogenesis
xfm00620  Pyruvate metabolism
xfm00640  Propanoate metabolism
xfm00680  Methane metabolism
xfm01100  Metabolic pathways
xfm01110  Biosynthesis of secondary metabolites
xfm01120  Microbial metabolism in diverse environments
xfm01130  Biosynthesis of antibiotics
xfm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xfm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Xfasm12_1451
   00620 Pyruvate metabolism
    Xfasm12_1451
   00640 Propanoate metabolism
    Xfasm12_1451
  Energy metabolism
   00680 Methane metabolism
    Xfasm12_1451
Enzymes [BR:xfm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Xfasm12_1451
Lipid biosynthesis proteins [BR:xfm01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Xfasm12_1451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACA12373
JGI: Xfasm121451
Position
1516361..1518304
Genome map
AA seq 647 aa AA seqDB search
MSDLYTIDPMLAKDAHVDRAHYKTLYHESIEQPEAFWSKVAQRLEWFKVPTKIKNVSYQL
EDVHIRWFEDGELNASVNCLDRHLTLRGDKTALLFEPDAPDAPSSRITYRELYERVCQLG
NALRHLGIEKGDRVTIYLPMIPDAVVAILACARIGAIHSVVFGGFAANSIADRVNDCGSK
LIITADEGLRGGRKIPLKANVDAALKIHGTQSVETVLVVRHTGGTINMHTPRDRWFHDLV
DIQATECAPERMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYTSYTHETVFDLRENDIY
WCTADIGWITGHSYIVYGPLANGATVLLFEGTPHYPTVSRFWEVIDKHHVTLFYTAPTAI
RALMREGDTPVKKTSRKSLRLLGSVGEPINPEAWHWYYTIVGNGRCPIVDTWWQTETGGI
LITPLIGATDLKPGSVTLPFFGIRPALVDTNGQTLDGPAAGNLVLLDSWPGQMRTLYGDH
QRFIDTYFRTYPNTYFTGDGCRRDADGYYWITGRVDDVINISGHRIGTAEIESTLVAHPK
VAEAAVVGFPHPIKGQGIYAYVTLITGETPSEALHQELLTRVRKEIGAIAIPDHVQWTPN
LPKTRSGKIMRRILRKIAENAPDQLGDTSTLADPSIVDLLLNERLKH
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacctgtacaccattgatccgatgttggccaaagatgcgcacgtagaccgtgct
cactacaaaacgctttaccacgaatccatcgaacaaccagaagcattctggagcaaagtc
gcacagcggctggagtggttcaaagtgccaaccaaaatcaaaaatgtcagctaccaactg
gaagatgttcacatccgttggttcgaagacggtgaactcaatgccagcgtcaactgcctg
gaccgccatctcaccttacgtggcgacaaaacagcactcctgtttgaacctgacgcccca
gacgccccatcctcacgcatcacctaccgtgaactatacgagcgcgtctgccaactcggt
aacgcactgcgccacctcggcatcgaaaagggcgaccgcgtcaccatctacttaccaatg
attccagatgcagtcgtcgccatcctcgcttgcgcacgcattggagcaatccactccgtc
gtcttcggcggctttgcagcaaactccattgccgaccgagtgaatgactgcggtagcaaa
ctcatcatcaccgcagatgaagggctgcgtggcggcagaaaaattccattgaaagccaac
gtcgatgccgcattaaaaatccacggaacccagtccgtcgaaaccgtactcgtcgtgcgt
cacaccggcggtacgatcaacatgcataccccgcgcgaccgctggttccatgacctcgtc
gacatccaagcaaccgaatgcgccccagaacgcatgaacgctgaagacccccttttcatc
ctctatacctccggctccacaggcaaacccaaaggagtcctgcacaccaccggcggctac
ctggtgtacaccagctacactcatgaaaccgtgtttgacctacgcgaaaacgacatctac
tggtgcactgccgacatcggctggattactggtcacagctacatcgtttacggcccccta
gccaatggcgccaccgtcttgctgtttgaaggcaccccccactacccgaccgtgtcgcgc
ttctgggaagtgatcgacaaacatcacgtcaccctcttctacaccgcgccgaccgcaatc
cgtgccttgatgcgcgaaggcgacactcctgtaaaaaaaacctcccgcaaaagcttgcgg
ttacttggcagcgttggcgaacccatcaaccccgaagcctggcactggtactacaccatc
gttggcaacggacgctgccccattgtcgacacctggtggcaaaccgagacaggaggaatc
ctcatcaccccactgatcggtgcaaccgaccttaaaccaggctcagtcaccctccccttc
ttcggcatacgccccgccctagtggataccaacggacaaacactggatggccccgcagca
ggtaacctagtcctgctcgattcctggccgggtcaaatgcgtaccctctacggtgaccac
caacgttttatagacacttactttcgcacctaccccaatacttacttcaccggcgacggc
tgccgccgcgatgccgacggctattactggatcactggacgtgtggatgacgtcatcaac
atctccggccatcgcatcggcaccgccgaaatcgaaagcacactcgtcgctcaccccaaa
gtggctgaagccgcggtcgtcggcttccctcacccgatcaaaggccagggcatctacgca
tacgtgacattaattaccggcgagacacccagcgaagcactgcaccaagaactgctcacc
cgggtacgcaaagaaatcggagcaatcgccatacccgatcacgtgcaatggacacccaac
ctccccaaaacccgctccggaaagatcatgcgccgcatcctgcgcaaaattgcagaaaac
gcaccagaccaactcggtgacacctccacactggctgatccgtctatcgtcgacttattg
ctcaacgaacgactgaaacactga

DBGET integrated database retrieval system