KEGG   Xylella fastidiosa M12: Xfasm12_1451Help
Entry
Xfasm12_1451      CDS       T00677                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
xfm  Xylella fastidiosa M12
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xfm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Xfasm12_1451
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Xfasm12_1451
   00620 Pyruvate metabolism
    Xfasm12_1451
   00640 Propanoate metabolism
    Xfasm12_1451
  Energy metabolism
   00680 Methane metabolism
    Xfasm12_1451
Enzymes [BR:xfm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Xfasm12_1451
Lipid biosynthesis proteins [BR:xfm01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Xfasm12_1451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1516361..1518304
Genome map
AA seq 647 aa AA seqDB search
MSDLYTIDPMLAKDAHVDRAHYKTLYHESIEQPEAFWSKVAQRLEWFKVPTKIKNVSYQL
EDVHIRWFEDGELNASVNCLDRHLTLRGDKTALLFEPDAPDAPSSRITYRELYERVCQLG
NALRHLGIEKGDRVTIYLPMIPDAVVAILACARIGAIHSVVFGGFAANSIADRVNDCGSK
LIITADEGLRGGRKIPLKANVDAALKIHGTQSVETVLVVRHTGGTINMHTPRDRWFHDLV
DIQATECAPERMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYTSYTHETVFDLRENDIY
WCTADIGWITGHSYIVYGPLANGATVLLFEGTPHYPTVSRFWEVIDKHHVTLFYTAPTAI
RALMREGDTPVKKTSRKSLRLLGSVGEPINPEAWHWYYTIVGNGRCPIVDTWWQTETGGI
LITPLIGATDLKPGSVTLPFFGIRPALVDTNGQTLDGPAAGNLVLLDSWPGQMRTLYGDH
QRFIDTYFRTYPNTYFTGDGCRRDADGYYWITGRVDDVINISGHRIGTAEIESTLVAHPK
VAEAAVVGFPHPIKGQGIYAYVTLITGETPSEALHQELLTRVRKEIGAIAIPDHVQWTPN
LPKTRSGKIMRRILRKIAENAPDQLGDTSTLADPSIVDLLLNERLKH
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacctgtacaccattgatccgatgttggccaaagatgcgcacgtagaccgtgct
cactacaaaacgctttaccacgaatccatcgaacaaccagaagcattctggagcaaagtc
gcacagcggctggagtggttcaaagtgccaaccaaaatcaaaaatgtcagctaccaactg
gaagatgttcacatccgttggttcgaagacggtgaactcaatgccagcgtcaactgcctg
gaccgccatctcaccttacgtggcgacaaaacagcactcctgtttgaacctgacgcccca
gacgccccatcctcacgcatcacctaccgtgaactatacgagcgcgtctgccaactcggt
aacgcactgcgccacctcggcatcgaaaagggcgaccgcgtcaccatctacttaccaatg
attccagatgcagtcgtcgccatcctcgcttgcgcacgcattggagcaatccactccgtc
gtcttcggcggctttgcagcaaactccattgccgaccgagtgaatgactgcggtagcaaa
ctcatcatcaccgcagatgaagggctgcgtggcggcagaaaaattccattgaaagccaac
gtcgatgccgcattaaaaatccacggaacccagtccgtcgaaaccgtactcgtcgtgcgt
cacaccggcggtacgatcaacatgcataccccgcgcgaccgctggttccatgacctcgtc
gacatccaagcaaccgaatgcgccccagaacgcatgaacgctgaagacccccttttcatc
ctctatacctccggctccacaggcaaacccaaaggagtcctgcacaccaccggcggctac
ctggtgtacaccagctacactcatgaaaccgtgtttgacctacgcgaaaacgacatctac
tggtgcactgccgacatcggctggattactggtcacagctacatcgtttacggcccccta
gccaatggcgccaccgtcttgctgtttgaaggcaccccccactacccgaccgtgtcgcgc
ttctgggaagtgatcgacaaacatcacgtcaccctcttctacaccgcgccgaccgcaatc
cgtgccttgatgcgcgaaggcgacactcctgtaaaaaaaacctcccgcaaaagcttgcgg
ttacttggcagcgttggcgaacccatcaaccccgaagcctggcactggtactacaccatc
gttggcaacggacgctgccccattgtcgacacctggtggcaaaccgagacaggaggaatc
ctcatcaccccactgatcggtgcaaccgaccttaaaccaggctcagtcaccctccccttc
ttcggcatacgccccgccctagtggataccaacggacaaacactggatggccccgcagca
ggtaacctagtcctgctcgattcctggccgggtcaaatgcgtaccctctacggtgaccac
caacgttttatagacacttactttcgcacctaccccaatacttacttcaccggcgacggc
tgccgccgcgatgccgacggctattactggatcactggacgtgtggatgacgtcatcaac
atctccggccatcgcatcggcaccgccgaaatcgaaagcacactcgtcgctcaccccaaa
gtggctgaagccgcggtcgtcggcttccctcacccgatcaaaggccagggcatctacgca
tacgtgacattaattaccggcgagacacccagcgaagcactgcaccaagaactgctcacc
cgggtacgcaaagaaatcggagcaatcgccatacccgatcacgtgcaatggacacccaac
ctccccaaaacccgctccggaaagatcatgcgccgcatcctgcgcaaaattgcagaaaac
gcaccagaccaactcggtgacacctccacactggctgatccgtctatcgtcgacttattg
ctcaacgaacgactgaaacactga

DBGET integrated database retrieval system