KEGG   Xylella fastidiosa M12: Xfasm12_1461Help
Entry
Xfasm12_1461      CDS       T00677                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
xfm  Xylella fastidiosa M12
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:xfm00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1530686..1532185
Genome map
AA seq 499 aa AA seqDB search
MKKKYILAIDQGTTSSRAILFDHKGRITGMAQREFTQIFPQPGWVEHNPRDIMTSVYTTI
TELLNNTQIDVRAIAGIGITNQRETTVIWNRQTGQPIYNAIVWQSRQTKNICDQLTTAGY
QDLVHAKTGLLMDAYFSGTKVKWILDHAENAHTQAARGELAFGTIDTWIIWNLTGGQVHV
TDYSNASRTLMYDIHALRWDPDLLTMLDIPAAILPDVRSSSEIYGLTQTPYFHGEQIPIA
GIAGDQQAALFGQACFEPGMAKNTYGTGCFMLMHTGKKAVESKNGLLTTIAWGLNGEIEY
ALEGSIFIAGSVVQWLRDGLRMFGKASDSQAYADRVSDNGGVYVVPAFVGLGAPYWRSDV
RGAVFGLTRSTTKEHFVRAALESMAYQTRDVLSAMQADADIELKELRTDGAAITNDFMAQ
FQSDILAVPVLRSQIAETTALGAAYLAGLATGFWSSREEMTQHWAINRCFKPQMDKEQRE
HLYAGWKQAVAATLGFRVA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaaatacatactggccattgaccaaggcaccaccagctcccgggccattctg
tttgaccacaaaggccgcatcaccgggatggcacagcgggaattcacccagatatttccc
caacctggctgggtcgaacacaacccgcgcgacatcatgaccagtgtgtacaccacgatc
accgaactgctcaacaacacccagattgacgtgcgcgccatcgccggaatcggtattacc
aaccaacgcgaaacaaccgtcatctggaatcgtcagaccggccaaccgatctacaacgca
atcgtttggcaatcacgccaaaccaagaacatctgcgaccaactcacgaccgccgggtac
caagatctggttcacgccaaaaccggactcctgatggacgcctatttttcaggcaccaag
gtgaaatggattctggaccatgccgaaaacgcacatacacaagcagcacgcggagaactg
gcattcggcaccatcgacacctggatcatctggaacctgaccggcggccaagtccatgtc
accgattacagcaacgcctcacgcaccctgatgtacgacatccacgccctgcgttgggat
ccagacctgctgacaatgctcgacataccagcggcgatcctgccggacgtccgttcatcc
agcgaaatttacggtctcacccaaaccccgtatttccacggagaacagataccgattgcc
ggaatcgccggcgatcagcaagccgcactcttcggccaagcctgtttcgaacctggcatg
gccaaaaacacctacggcaccggctgtttcatgctgatgcacaccggcaaaaaagccgtg
gaatccaaaaatggactactcactacgatcgcttggggcctgaatggagaaatcgagtac
gcactagaaggctcgatcttcatcgctggctctgtggtgcaatggctgcgcgatggatta
cgcatgttcggcaaagccagcgattcacaagcctacgccgaccgtgtcagcgacaacggc
ggcgtgtacgttgtaccggccttcgttggcctgggtgcgccctactggcgtagcgatgtc
cgcggcgcagtgttcggactgacacgcagcaccaccaaagaacacttcgtccgcgccgca
ctagaatcgatggcctaccaaacccgcgacgtcctgagcgcaatgcaggcagatgcagac
atcgaactcaaagaactacgcactgacggcgcggccatcaccaacgacttcatggcccaa
ttccagagcgatatcctcgccgtgccagtgctgcgctcgcagatcgccgaaaccacagca
ctcggtgccgcctacctggctggacttgcgaccggattttggtcaagccgcgaagagatg
acgcaacactgggcgatcaatcgctgcttcaagccacagatggataaggaacaacgcgag
cacctatacgcaggctggaaacaggccgtcgcagccacattaggcttccgtgtggcctga

DBGET integrated database retrieval system