KEGG   Xylella fastidiosa M12: Xfasm12_1591Help
Entry
Xfasm12_1591      CDS       T00677                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
xfm  Xylella fastidiosa M12
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:xfm00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:xfm00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xfm00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:xfm00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1663356..1664246)
Genome map
AA seq 296 aa AA seqDB search
MIKRIRKAVFPVAGLGTRFLPATKTIPKEMLPIIDKPLIQYAVDEAIQAGCDTLVFVTNR
YKHAVADYFDKAYELEQKLERAGKYEQLELVRHVLPDGVRTVFVTQTEALGLGHAVLCAK
PVVGDEPFAVLLPDDLMWSRNGGALKQMADVAEVSGSSVIAVEDVPVDKTVNYGIVGTDV
FDGSKGRITQIVEKPKPDDAPSNLAVVGRYVLSGKIFEMLENTSIGTGGEIQLTDAIAEL
LKYERVDAYRFQGRRFDCGAHIGLIEATLHLALEHKKHGQAVREILRDTLLTVDKR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgattaagcgtattcgcaaggctgttttccctgtggccggtcttggtacacgttttttg
ccagcgaccaaaaccatccccaaggaaatgctgccaattatcgataaacccctcatccag
tacgcggttgacgaagcgatccaggctggatgcgatacccttgtgtttgtgaccaaccgt
tacaagcatgcggtggccgattacttcgacaaagcgtatgaattggagcagaagcttgag
cgtgccggtaaatatgagcagctggaattagtgcgtcatgtgttgcctgatggagtgcgt
acggttttcgtcactcaaactgaagcgctgggtctaggccatgcggtgttgtgcgccaag
ccggtggtgggtgatgaaccattcgcggtgttgctgccagacgatctcatgtggagtcgt
aatggaggtgcactgaaacaaatggctgatgttgctgaagtctccggtagcagtgtcatt
gcagtagaggatgtccccgtcgataaaaccgttaactatggcatcgtcggaacggatgtg
tttgacggatccaagggccgcattactcaaatcgtcgaaaagcctaagcccgacgatgca
ccgagcaatcttgctgtggtggggcgctatgtcctgagtggcaagatattcgagatgctt
gaaaacacctctatcggtactggcggcgagattcaattgacagatgcgatcgctgaatta
ctgaaatacgagagagtggatgcataccgcttccaaggtcgccgatttgattgtggtgca
cacattggtctgattgaggctaccctgcatttagcccttgaacacaagaaacatggccag
gcggtgcgtgagatcctgcgtgacacattacttacggtcgacaagagataa

DBGET integrated database retrieval system