KEGG   Xylella fastidiosa M12: Xfasm12_1591Help
Entry
Xfasm12_1591      CDS       T00677                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
xfm  Xylella fastidiosa M12
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xfm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Xfasm12_1591
   00052 Galactose metabolism
    Xfasm12_1591
   00500 Starch and sucrose metabolism
    Xfasm12_1591
   00520 Amino sugar and nucleotide sugar metabolism
    Xfasm12_1591
Enzymes [BR:xfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Xfasm12_1591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1663356..1664246)
Genome map
AA seq 296 aa AA seqDB search
MIKRIRKAVFPVAGLGTRFLPATKTIPKEMLPIIDKPLIQYAVDEAIQAGCDTLVFVTNR
YKHAVADYFDKAYELEQKLERAGKYEQLELVRHVLPDGVRTVFVTQTEALGLGHAVLCAK
PVVGDEPFAVLLPDDLMWSRNGGALKQMADVAEVSGSSVIAVEDVPVDKTVNYGIVGTDV
FDGSKGRITQIVEKPKPDDAPSNLAVVGRYVLSGKIFEMLENTSIGTGGEIQLTDAIAEL
LKYERVDAYRFQGRRFDCGAHIGLIEATLHLALEHKKHGQAVREILRDTLLTVDKR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgattaagcgtattcgcaaggctgttttccctgtggccggtcttggtacacgttttttg
ccagcgaccaaaaccatccccaaggaaatgctgccaattatcgataaacccctcatccag
tacgcggttgacgaagcgatccaggctggatgcgatacccttgtgtttgtgaccaaccgt
tacaagcatgcggtggccgattacttcgacaaagcgtatgaattggagcagaagcttgag
cgtgccggtaaatatgagcagctggaattagtgcgtcatgtgttgcctgatggagtgcgt
acggttttcgtcactcaaactgaagcgctgggtctaggccatgcggtgttgtgcgccaag
ccggtggtgggtgatgaaccattcgcggtgttgctgccagacgatctcatgtggagtcgt
aatggaggtgcactgaaacaaatggctgatgttgctgaagtctccggtagcagtgtcatt
gcagtagaggatgtccccgtcgataaaaccgttaactatggcatcgtcggaacggatgtg
tttgacggatccaagggccgcattactcaaatcgtcgaaaagcctaagcccgacgatgca
ccgagcaatcttgctgtggtggggcgctatgtcctgagtggcaagatattcgagatgctt
gaaaacacctctatcggtactggcggcgagattcaattgacagatgcgatcgctgaatta
ctgaaatacgagagagtggatgcataccgcttccaaggtcgccgatttgattgtggtgca
cacattggtctgattgaggctaccctgcatttagcccttgaacacaagaaacatggccag
gcggtgcgtgagatcctgcgtgacacattacttacggtcgacaagagataa

DBGET integrated database retrieval system