KEGG   Xylella fastidiosa M12: Xfasm12_1655Help
Entry
Xfasm12_1655      CDS       T00677                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
xfm  Xylella fastidiosa M12
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xfm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Xfasm12_1655
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Xfasm12_1655
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Xfasm12_1655
Enzymes [BR:xfm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Xfasm12_1655
Exosome [BR:xfm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Xfasm12_1655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1729349..1731079)
Genome map
AA seq 576 aa AA seqDB search
MRFSIFRPSNHIMFRRFATFLILPVVSFAIAVSFPSAATSTQVSVPKVTPPAAETPQWWY
QSGATRAAANGAMAGKAKNVILFLGDGMSFTTVAAARILEGQRNAATGEENVLSWEHFPA
TAFSKTYNTDAQTADSAGSMTAITSGVKTHMGAIGVSAGQRNDCVDSLGKSLLTWLTLAD
SAGMATGIITTTRITHATLAALYAHTPERHWESDANLPEAAKAGGCRDIAQQLLTSTRYG
RGPLVVLGGGRAQFMPAHQHDPEYAERTGLRLDGRDLIEEWKRAHPNGAYVWNTHQFNAA
AGAPALLGLFEPSHMQFEHDRDRHPNGEPSLAEMTRTAIQSLSRDPHGFVLMVEGGRIDH
AHHAGNAYRALDETIALSDAVRAAVQTAPKDTLIIVTADHAHTLNFVGYPVRGNPILGKV
RSSSRDAGDRTQYAHDLNALPYTTLTYANGPGHTAASNTQSAGTKHFNHQPRTYELVRGR
PDLTTIDTQAPDYLQEALVPLKKESHSGEDVGIWATGPGSAAFRGVLEQHVIYHVIVQAT
PALRQRLCAAGTCNAAGVPIKLPQLADFERKGQRRE
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttctcaatttttcgaccatcaaatcacattatgttccgacgttttgctactttc
ctcattcttcctgtcgtgtcatttgccatagcggtttctttcccatctgctgccacttct
acccaggtgagcgtgcccaaagtgactcctcctgccgctgagaccccgcaatggtggtat
cagagcggcgctacacgcgctgcggctaacggtgccatggctggtaaagccaaaaacgtc
atcctatttctcggcgacggcatgagcttcaccaccgtagccgctgcacgcatcctggaa
ggccagcgcaacgctgccactggcgaagagaacgtattgtcctgggagcattttcctgcc
accgcattcagcaaaacctacaacaccgatgcccagaccgcagactcagccggttccatg
accgcgatcacctctggagtaaagacccacatgggcgcgatcggcgtcagtgcaggtcag
cgcaacgattgcgttgatagcctcggcaaaagtctacttacctggctgacactggcagac
agtgccggtatggcgaccggcatcataacgaccacccgtatcactcacgccaccctggcg
gcgctctacgcacataccccggaacgtcattgggaaagtgatgccaacctgcctgaagcc
gccaaagcgggcggctgccgcgatattgcccaacaactcctcacctctacccgctatggg
cgtggtcctctggtggtgctgggtggtggtcgcgcccaattcatgcctgcgcaccaacat
gaccccgaatatgctgagcgtactggcttacgtttggatggacgcgacctcattgaagaa
tggaaacgtgcacatcccaatggcgcttatgtgtggaacacccaccaattcaacgctgct
gctggcgcaccggccctgctgggtttatttgagcccagccatatgcagtttgaacacgat
cgcgaccgacaccccaacggcgagcctagcctggccgagatgacacgtaccgcgatccaa
tcgctgtctcgtgatccacatggttttgtactgatggttgaagggggccggattgatcac
gcccatcatgccggtaacgcctacagagccttggatgaaaccatcgcactctcagatgca
gtacgcgccgccgtacagacagcccctaaagataccttgattattgtcactgccgaccat
gcccatacccttaactttgttggctacccagtccgcggcaaccccatattgggcaaagtg
cgcagcagcagccgtgatgcaggagaccgcacccagtacgcacatgatttaaatgccttg
ccctataccacattgacttacgcaaacggtcctggccacaccgccgccagcaatacacag
tcggctggaaccaaacacttcaaccatcaaccccgtacctatgaattagtccgtggtcgc
ccagatctgaccacgatcgacacccaagcgcccgactatctgcaagaagcactggtccca
ctgaagaaggagagccacagcggcgaagacgtcggtatctgggccacaggccccggcagt
gctgcgttccgcggcgtccttgaacaacatgtcatctaccatgtcatcgtccaagcgaca
cccgcattacggcagcgcctgtgtgccgctggcacatgtaacgccgctggcgtgccgatc
aagttgccacagctggccgacttcgaacgcaaaggccagaggagggagtga

DBGET integrated database retrieval system