KEGG   Xylella fastidiosa M12: Xfasm12_1812Help
Entry
Xfasm12_1812      CDS       T00677                                 

Definition
exodeoxyribonuclease V (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
xfm  Xylella fastidiosa M12
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:xfm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Xfasm12_1812
Enzymes [BR:xfm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Xfasm12_1812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1879395..1881314)
Genome map
AA seq 639 aa AA seqDB search
MSLLAALNQAGVLRTLDDALARSLCRLDPKTPDKVAAAAALASMAVAHGHAGVDLAHPGL
LAGEMFDWPSAADWVHLLRASRWVAEPSEGEAPAPTGQPLVLEQGVLYLRRYREYERRLA
IGLRRIAAARLPPAESAAVATVFAALFPQARAGQDRQALAAALALQRALLLVTGGPGTGK
TTTIARLLLLRVAQARQQGQASLRIALAAPTGRAAERMAESLRAAAGHVSAAGGDAALFA
ALPSGASTVHRLLGVIPDTPRFRHCEDNPLPYDVIVVDEASMMDLPLMCKLVDAVADGTQ
LILLGDPDQLPSVEAGDVLAGILAAAGSGEVLDVADAQVLAPLLGAPSAAVVAECHVVRG
GLHGHRVHLQQSHRQGEDLALAPLAEAVRLGDATAVLGMLRRGTLRGVQFHEGVLDPCVG
AGQVLLAHWRALAALSDPVQALAAAGRLRLLTALREGPHGAAGINVRIERLLGGGGVDGY
FHGRLLLMTETSPRQRLFNGDIGVCLRDDDGTMWAWFSGAGGEGVRAFAPAALPAHESAF
AMTVHKAQGSEFDTVWLQLPRQESRVLSRELIYTGLTRARHGLHVAGSESVLCAALARQA
VRVSGLAWRLGVTGCNTVPIGAGAGDAEVFGKGGQGVLF
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgctcgccgcgctcaaccaggctggtgtgttgcgtacgttggatgatgcgttg
gcgcggagtttgtgccgtcttgatccgaagactccggacaaggtggccgctgccgctgcg
ctggcctcaatggcggtggcgcatggtcacgcgggtgtagatctggcccatcctggattg
ctcgctggagagatgttcgactggccttccgctgcggactgggtgcatctgctgcgcgcc
agtcggtgggtggccgagccatctgagggggaggcaccagcaccgactgggcagccgttg
gtgcttgagcaaggggtgctctatctgcgtcgctatcgtgagtatgagcggcgtttagcg
atcggtttgcgtcggattgccgctgcacggttgccaccggctgaatcggccgcggtggcg
acggtgtttgcggcgttgtttccacaggcacgcgctgggcaggatcgtcaggcattggcg
gctgcgttggcgttgcagcgtgcgttattgctggtcacgggggggcctgggactggcaag
acaacgacgattgcgcgcctgttattgctgcgtgtcgcccaggcgcggcaacaggggcag
gcgtcgttacgtattgcgctggccgcgccgacgggccgtgcggccgagcgaatggctgaa
agtctgcgtgcggcggcagggcatgtgtccgcggcggggggggatgcggcgttgtttgcc
gcgttgccgtcgggagcgagtacggtgcatcgtttgcttggggtgatccccgatacgccg
cgctttcgtcattgtgaggacaatccgttgccttatgacgtgatcgtggtggatgaggct
tcaatgatggatctgccgctgatgtgtaagttggtggatgctgtggcggacgggacgcag
ttgattttgctgggtgatccggatcagttgccgtcagtggaggcgggcgatgtgcttgcg
gggattcttgccgctgccggttccggtgaggtgttggatgtcgccgatgcgcaggtattg
gcgcccttgttaggcgcgccgtctgcagcggttgttgcagagtgtcacgttgtccgcggg
ggtttacatgggcatcgggtgcatctgcaacagagtcaccgtcagggtgaggatttagcg
ttggcgccgttggctgaggcggtgcgtttgggggatgcgactgcggtgctggggatgttg
cgtcgcggcacacttcgtggggtgcaatttcatgagggggtgttggatccgtgtgtcggg
gctggtcaggtgttgttggcgcattggcgtgcgttggctgcgttgtctgatccggtgcag
gcattggcagcggcggggcgattacgtttgttgacggcgttgcgtgaggggccgcatggg
gcggcggggatcaatgtgcggattgagcgcctgctcggcggcggcggtgtggatggttac
tttcatgggcggctgttgttgatgactgagactagtcctcgtcagcgtttgttcaatggt
gatattggggtgtgtcttcgggatgatgatgggacgatgtgggcttggttttccggtgct
gggggagagggtgtccgcgcatttgcaccggcggcgttgccggcgcatgagagtgcgttt
gcgatgacggtgcataaggcgcaggggtcggagttcgatacggtgtggttgcagttgccg
cgtcaggagagtcgggtgctgtcacgggagttgatctatacggggttgactcgtgcacgc
catgggttgcatgtggcgggcagtgagtcggtgttgtgtgcggcgttggcacggcaagcg
gtgcgtgtgtcggggctggcttggcggcttggtgttactggttgcaacacggtgccaata
ggggcaggtgcgggggatgcggaggtgtttggcaagggggggcaaggggtgttgttctga

DBGET integrated database retrieval system