KEGG   Xylella fastidiosa M12: Xfasm12_1863Help
Entry
Xfasm12_1863      CDS       T00677                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
xfm  Xylella fastidiosa M12
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:xfm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Xfasm12_1863
Enzymes [BR:xfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Xfasm12_1863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1943153..1944106
Genome map
AA seq 317 aa AA seqDB search
MHSVVVVGSFSIDHVWRCDTLPTPGATIAGRYSRGPGGKGFNQAVAACRAGARTYFICAL
GNDTDGNMARDIATKDGFTLIGESSTEPTGTGGIYVDSHGHNTIVTGAGANAVLSTHFIT
EQRALITSAWIVLAQLESPIETLETALRMAREAGRLTILNAAPANATATINLLKLADVLT
LNETEFVALLSRHVGERISPDNVATTDGNTLHALCNKLLSSSTVVITLGSAGVFVSHSEE
NLRGDTQPYYRVAAEQAHTVDTTGAGDAFNGALAASLARQPNTAFIQHIRLANSYAARST
ETEGGAVSMPILTTTSD
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcattcagtcgtcgtcgtcggctccttcagtattgatcatgtttggcgctgcgacaca
ttgcctacacctggtgcaacaattgccggccgctatagccgtggtccaggaggcaaaggc
ttcaaccaggccgtagcggcttgccgcgctggtgcacgcacctatttcatatgcgcactc
ggcaatgacaccgacggcaacatggcacgcgacatcgccacaaaagacggcttcacactg
atcggcgaatccagcaccgaacccactggtaccggagggatctatgtcgacagccacggc
cataacactatcgtcactggcgctggtgccaacgcagtactgagcacccacttcatcaca
gaacaacgcgccctaattacctcagcatggatcgtcttggcacaactggaatcaccgata
gaaacactcgaaacggcgctcagaatggcgcgcgaagctggccgcttgaccatactcaat
gctgcccccgccaatgcaaccgccacgatcaacctgctcaaattggccgacgtgctcaca
ctgaacgaaacggaattcgtcgctttgctcagccgtcacgtcggtgaaaggatcagtccc
gacaacgtcgccaccaccgatggcaacacactacacgccttatgcaacaaactactgtcc
agcagtacggttgtcattacattaggctcggctggcgtattcgtttcacactcggaagaa
aacctgcgtggtgacacccagccctactatcgcgtggccgccgaacaggcccacaccgta
gacaccaccggagctggcgacgcatttaatggtgctttggcagcatccctggcacggcaa
ccaaacacagcgtttatccagcacatacgcctcgccaatagctatgcagcgcgctcgacc
gaaacagaaggtggagccgtatcaatgccaatattaacgaccacctcagactaa

DBGET integrated database retrieval system