KEGG   Xylella fastidiosa M12: Xfasm12_2009Help
Entry
Xfasm12_2009      CDS       T00677                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
xfm  Xylella fastidiosa M12
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:xfm00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2099224..2101062
Genome map
AA seq 612 aa AA seqDB search
MLRHLLTLPLIFAIALPIGVSAAPWPAFSTRGTQFIRDGRPYQLISGAIHFQRIPRAYWK
DRLQKARAMGLNTVETYVFWNLVELREGQFDFTGNNDIGAFVREAASQGLNVILRPGPYV
CAEWEAGGFPAWLFADPTLRVRSQDPRFLDASQRYLEALGTQVRPLLNSNGGPIIAMQVE
NEYGSYGDDHGYLQAVRALFIKAGLGGALLFTSDGAQMLGNGTLPDVLAAVNVAPGEAKQ
ALDKLATFHPGQPQLVGEYWAGWFDQWGKPHAQTDAKQQADEIEWMLRQGHSINLYMFVG
GTSFGFMNGANFQGGPGDHYSPQTTSYDYDAALDEAGRPMPKFALFRDVITGVTGLQPPP
LPAATRFIDLPDTPLRASASLWDNLPAAVATSADPQPMERYGQAYGYILYRTTIHGPRKG
RLYLGEVRDDAHVYVDRLFVGRAERRRQQVWVEVDIPSGTHRLDVLVENSGRVNYGPHLA
DGRAGLIGPVMLNHERVNNWETFLLPLQTPEAIHGWTTAPMQGPAFHRGTLFIRTPGDTF
LDMEAFSKGVTWANGHMLGRYWDIGPQRALYFPGAWQRQGENTVLVFDVSDTAAAQVRGV
QQQRWITPRTAK
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgtcacctgctcacgttgccgctgatattcgcaatcgcgctgcccattggagtt
agcgccgcgccttggcctgctttttcaactcggggaacgcaattcatccgtgatgggagg
ccgtatcagttgatctcgggtgccatccacttccaacgcatcccgcgggcgtactggaag
gaccgtttgcaaaaagcccgagcaatggggttgaacacggtggaaacctatgttttctgg
aacctggttgaactccgtgaaggtcaattcgacttcacagggaataacgacattggtgct
tttgtgcgtgaagcagcgtcgcaaggtctgaacgtgattctgcgtcccgggccatatgtg
tgtgcagaatgggaggcaggggggttcccagcgtggctgttcgccgatccgacgctacgg
gtgcgcagtcaggatccgcgttttcttgatgccagtcagcgctatctggaggcactcggc
acacaggtcaggccgctgctcaatagcaatggcggtcccatcattgcaatgcaggttgag
aatgagtacggctcttatggggatgatcatggctatctacaggctgtgcgcgcgctattc
atcaaggccggtttgggaggtgcgctgttgtttacctccgacggggctcagatgcttggc
aatggcacgctgccggacgtgctagcggcggtgaatgtcgcaccgggtgaggcaaaacag
gcgctcgacaagctcgccacattccatcctgggcagccgcagctggtgggtgaatattgg
gcggggtggttcgaccagtggggcaagccgcacgcgcagaccgatgcaaagcagcaggct
gatgagatcgaatggatgctgcggcaaggccattcgatcaatctgtatatgtttgttggc
ggcaccagttttggttttatgaatggtgctaacttccaaggtggtcccggtgaccattac
agccctcaaaccacaagctacgattacgatgcagcgttggacgaagcaggacggccgatg
ccgaagttcgcgctgttccgcgatgtcatcaccggcgtgaccggtctccagccgccgcct
ttgccagcggcaacccgttttatcgatctgccggacacgccattgcgcgcatccgcttcg
ctctgggacaacctgcctgcagcggtcgccacctcagcagatccgcagccgatggagcgc
tatgggcaggcctacggttacattctgtaccgcaccacgatccacggcccacggaagggc
aggctgtatctgggtgaggtgcgggatgacgcccatgtctacgttgatcgtctcttcgtg
ggtcgggcggaacggcgtcggcagcaggtctgggtggaggttgacattccctccggtact
caccgtctggatgtcttggtagaaaacagtggacgggttaactacggtccgcacctggct
gacggccgtgccgggctgattggtccggtgatgctcaatcatgaacgcgtcaacaattgg
gaaacgtttctgctgccgttgcagacgcccgaagcgatccacggttggacaaccgcaccg
atgcaaggacctgcttttcatcgtggcacgttgtttatccgcacgcctggagacacattt
ttggatatggaggctttcagcaagggagtgacctgggccaatggtcacatgcttggccgc
tactgggacatcggcccgcagcgggcgctttacttcccgggggcgtggcagcgccaaggg
gagaatacggtgctcgtcttcgatgtgagcgatacggcagcagcacaggtacgcggtgtg
cagcagcaacgctggatcactccaaggacggccaagtaa

DBGET integrated database retrieval system