KEGG   Xylella fastidiosa M12: Xfasm12_2256Help
Entry
Xfasm12_2256      CDS       T00677                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xfm  Xylella fastidiosa M12
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xfm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Xfasm12_2256
Enzymes [BR:xfm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Xfasm12_2256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2386928..2387998
Genome map
AA seq 356 aa AA seqDB search
MPISFLYPLCLLPSCFLILLTSLTTLAPASPSHTTNILTYAGINLAGPEFSPSNKPGVLY
KDYLYPSASDYAYVVKKGMNIVRLPVLWERVQPTLNDALDATQLNLILNAVEQAKAQKLH
IILDIHNYAKHNDELIGSDNVPISAFADLWKRLSLQFANDKAVIFGLMNEPHEITSTTWA
KAAQAAINAIRSTGARNLVLVPGTAYSGAHSWLSSYYGIPNGEALLNINDPAKHMTFEVH
QYTNENSTGTTGECISTTIGAEKLEAFTNWLRTYHKTGFLGEFATGNNDTCNQALEGMLS
YIEENADVWLGLTWWGYNPWFSPNYPFNLYPNSDGSDKPQMSILESHTRKITKIHK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcccatttcctttctataccctttatgcctcctcccctcctgtttcctaatactgctc
acaagcttgacgacactggcaccagcatcaccaagccataccacaaacatactgacgtac
gctggtatcaaccttgctggcccggaattcagcccaagcaataaaccaggtgttctctat
aaggactatctttatccaagtgcatctgactacgcttacgtggtcaaaaagggcatgaac
atcgtgcgcctccctgtcctttgggaacgcgttcagcccacactgaatgatgcattggac
gccacgcaactcaacctgattcttaacgccgtcgagcaagcgaaagcccagaaattacat
atcattctagatatccataactacgccaaacacaacgatgagctgatcggcagtgacaat
gtccctatcagcgccttcgccgatctatggaagcgtctgtccctacagtttgccaacgac
aaagcagtcatcttcgggctgatgaacgagcctcatgaaatcacctcaaccacttgggct
aaggctgctcaagcagccatcaacgcaatccgcagcactggcgcacgtaaccttgtgtta
gtgccgggtaccgcttacagcggtgcacacagttggctgagcagctactacggcatccct
aatggagaagcgctgctgaacatcaatgatcctgccaaacacatgacgttcgaagtacac
caatataccaatgaaaatagcaccggcacgacgggcgaatgcatcagcaccaccatcgga
gccgagaagctagaagcattcaccaactggctgcgcacctaccacaaaaccggtttcctt
ggcgagttcgctactggcaacaacgatacttgcaaccaagcattggaaggcatgctcagc
tatattgaggaaaacgcagacgtctggttgggactgacgtggtggggatataacccctgg
tttagtcccaattatccattcaacctgtatccaaacagtgacggcagcgacaagccgcag
atgagcatcctggaatcacacacacgtaagatcactaaaatccacaaataa

DBGET integrated database retrieval system