KEGG   Xylella fastidiosa M23: XfasM23_0082Help
Entry
XfasM23_0082      CDS       T00692                                 

Gene name
asnB
Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
xfn  Xylella fastidiosa M23
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:xfn00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
111525..113216
Genome map
AA seq 563 aa AA seqDB search
MCSIFGIFNLQPSDNLQILRHQALECSQRQRHRGPDWSGVYVDVGAILVHERLAIVDPAG
GAQPLFSEDGTLALAVNGEIYNHAVLKGTLQQPYAFQTHSDCEVINALYREETPTSFLNR
LNGIFAFALWDKTTGRGLIARDPMGVVPLYWGHDQDGRLRVASEMKALVEHCPDVAQFPP
GHWYDTTTGTLVKYYERPWKNYSAVEGVQVSLQELREAFERAVHRQLMTDVPYGVLLSGG
LDSSLVAAVAARYARHRIETNDQSEAWWPRLHSFAIGLKDSPDLSAANVAAEALNTVHHG
FEYTFQEGLDVLPEVIRHIETYDVTTIRASTPMFLLARRIKAMGVKMVLSGEGSDEIFGG
YLYFHKAPNAREFHEELVRKLNALYYYDCLRANKAMMAWGVEPRVPFLDREFLDVAMRMD
AQHKMVDKTSNGPQRMEKGILRAAFDGYLPPSILWRQKEQFSDGVGYGWIDGLKAHAETQ
VSDHALATAETRFQVNPPQTKEAYYYRSIFERFFPSPAAAETVPGGKSIACSSPAAIAWD
ASFATMADPSGRAVSGVHQQALL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtgttccatttttggaatcttcaacctgcaacccagtgacaacctacagatactgcgt
caccaagcattggagtgctcgcaacggcaacggcatcgcggacccgattggagcggcgtt
tacgttgatgtgggtgcgattctggtgcacgaacgtcttgctatcgtcgatccagccggc
ggtgcccagccactgttctccgaggatggcaccctggcgttggcggtcaacggcgaaatc
tataaccacgctgtactcaaaggaacattgcagcagccctatgcgttccaaactcattct
gattgcgaagtgattaatgcgctttaccgcgaagaaactccaacctcgtttctgaatcgc
ttaaatggaatttttgcattcgcattatgggacaagaccaccggacgtggcctcatcgca
cgcgatccaatgggcgtggtgccgctgtactgggggcacgatcaggatggtcgcttacgc
gtcgcgtcagagatgaaagcattggttgagcattgccccgatgttgcacaattcccaccc
ggccattggtacgacaccacaacgggcacgctggtgaagtattacgaacgcccctggaaa
aactattctgcagtggaaggagtgcaggtctcactacaggaactgcgtgaagccttcgag
cgggccgtccatcgtcaactcatgaccgatgttccatacggtgtactgctgtctggtgga
ttggattcttccctggtggctgcggtggccgcacgctacgcacgccatcgcatcgaaacc
aatgatcagagcgaagcatggtggccacgtctgcactcatttgcgattggactgaaagac
tcgccagatttgagtgcggcgaacgtggctgctgaggcgttgaataccgtccaccatggt
ttcgagtacaccttccaggaggggctggatgttttacctgaagtgattcgtcacattgaa
acttacgatgtcacgacgattcgcgcatccacaccaatgttcctgctggcacgtcgcatt
aaggcgatgggagtgaagatggtgttgtcaggtgaaggcagcgatgaaatttttggcggt
tacctgtacttccacaaagcgccgaacgcacgcgagttccacgaagaattggtccgtaag
ctcaacgccctgtattactacgactgcttgcgcgccaacaaagcgatgatggcgtggggt
gtcgagccgcgcgtgccgtttttggaccgtgaatttctcgatgtggctatgcggatggat
gcgcagcataagatggtcgacaagaccagcaacggcccacaacggatggagaaaggcatc
ctgcgtgcagcgtttgacggctatttgccgccatcaatcctgtggcgacagaaggagcag
ttcagtgatggtgttggctacggttggatcgacggactgaaagcacacgctgaaacgcaa
gtgtctgaccatgcgctggcaactgccgagacacgtttccaggtgaatcctccccagacc
aaagaagcctattactaccgcagcatatttgagcgcttcttcccaagcccggcggcggct
gagacggtaccgggcggtaaatcaatcgcctgttcttcaccggcggcgattgcctgggat
gccagctttgccacaatggctgacccatccggtcgtgcagtcagcggggttcatcaacaa
gcactgctgtag

DBGET integrated database retrieval system