KEGG   Xylella fastidiosa M23: XfasM23_0113Help
Entry
XfasM23_0113      CDS       T00692                                 

Definition
phosphoglucomutase/phosphomannomutase subunit alpha/beta
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
xfn  Xylella fastidiosa M23
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xfn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XfasM23_0113
   00030 Pentose phosphate pathway
    XfasM23_0113
   00051 Fructose and mannose metabolism
    XfasM23_0113
   00052 Galactose metabolism
    XfasM23_0113
   00500 Starch and sucrose metabolism
    XfasM23_0113
   00520 Amino sugar and nucleotide sugar metabolism
    XfasM23_0113
  Nucleotide metabolism
   00230 Purine metabolism
    XfasM23_0113
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XfasM23_0113
Enzymes [BR:xfn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     XfasM23_0113
    5.4.2.8  phosphomannomutase
     XfasM23_0113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
151926..154469
Genome map
AA seq 847 aa AA seqDB search
MSVTIGNELILPMKRRRIAFLLAMLCLLLAGVFCWGAYIQWRQNVVQQKLEQARDGAVAS
LLQVLSAQVKQLQNVVQRPAIVQVLGGGDVTAAAAAVREQFPGTEDVQVLTGDLSAAYAD
VARSGYARLGLIEAALGGDGVKAWVVRDGTQIGLGMAVMVKLGQAPAVVYLRLPLRGLIS
VLDAIEVPNSTYLALRQGSYTVVERGSAALASGGEALAKPLGWADLRMAAAVPQLENVPF
DLGLLPSLIVVGVFALVAAVLLLVAGGHRMLPRRHGQMADAEQEQVTLRESVMQEAPERA
IVLNDENKENKENKENKENKENKENKENKENKENKENKENKENKENKENKENKENKENKE
NKENKENNVALSSSLHLQFNLEAVVQPSLFHEDDIHGVVPSELNPGVAKLIGQAIGSAMQ
AKGLSDIVIGRDGRVSSSELSAALSDGLRHAGCNVVDIGLVPIPVVYFAACHLGVWSCVA
VTGGHHPHDYNGFKIVLGGESLSSEAMSDLYQCITNGRLYASVDSGSLSERDVVDDYIQR
IADDVQLNRPLKIVVDPGHGAAEEILSRLFKAIGADLVSLYGDIDGVSLIVHPDSGEPGN
LQKLIQRVERADADLGLAFDGDAESLRVVTREGEVILSDSVLMLFATDVLQRNPGALVIY
DAECTSKLSDYVLRNGGSPLMWKIGHSSIKAKMRETGAELAGEMSGYFFFKERWYGFEDA
LYAAARLLEILAQREDNPSQVFAALPHAYFTAQMEQSVEGDAQACVQSFIEEVQRSVEGG
VFDGARLFAFDGLRADFTDGWGLVRVSDTASALVLRFEADTQAGLERIQSAFRTHLQALL
PGQVLVF
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgacaattggaaacgagttgattttgccgatgaaacgacgccggattgcattt
cttttggcgatgttgtgtttgttgctggcaggggtgttttgttggggggcgtacatacag
tggcgccagaatgtggtgcagcagaagctcgagcaggcacgtgatggtgctgttgcgtca
ttgcttcaggtgctgtctgctcaggttaagcagttgcaaaatgtggtgcagcgtccggcc
atcgtacaggtgctgggtggaggtgacgtcacggcagcagctgcagcggttcgtgagcaa
tttccaggcactgaggatgtacaggttctgaccggcgatctgagtgctgcttatgcggat
gtggcgcgctccggttatgcccgccttgggctgatagaggcggctcttggtggtgatggt
gtgaaggcatgggttgtacgtgacggtactcagattggcttgggtatggctgtgatggtc
aagcttggccaagctccggcggtggtctatcttcgcctgccgctacgtggcttgataagt
gtgttggatgcgattgaggtgcccaatagcacttacttggcattgcgtcaggggagttat
acggtggtcgagcgcggtagcgccgcgttagccagtggtggtgaggcattggctaaaccg
ctgggttgggctgacttgcgtatggctgccgctgtgccgcagctggaaaacgtccctttt
gatttgggattgctgccatctttgattgtggtaggggtgtttgcgctagttgcggcggtc
ctgttgttagttgcgggtgggcataggatgctacccaggcgtcacgggcaaatggccgat
gcagaacaagaacaggttactttgcgtgaaagtgtgatgcaggaggcgccggagcgcgcg
atcgttttgaatgacgaaaacaaggaaaacaaggaaaacaaggaaaacaaggaaaacaag
gaaaacaaggaaaacaaggaaaacaaggaaaacaaggaaaacaaggaaaacaaggaaaac
aaggaaaacaaggaaaacaaggaaaacaaggaaaacaaggaaaacaaggaaaacaaggaa
aacaaggaaaacaaggaaaacaacgttgcgttgtcgtcgtcgctgcatcttcagttcaat
ttggaagcggtggttcaacctagtcttttccatgaagacgatatccacggtgtggtccct
agcgagttgaacccaggtgtggcgaagttgatcggtcaagcgatcggcagtgcgatgcag
gccaaaggtttgagtgacattgtgattggccgtgacggccgcgtgtccagttctgagttg
tccgcagcattaagtgatggtctacgtcatgccggttgcaatgtggtagacatcggcttg
gtgccgatccctgtagtgtatttcgctgcctgccatcttggcgtttggagttgcgttgcg
gtcacaggggggcatcatcctcatgattacaacggtttcaagatcgtgcttggtggtgag
tccttatccagtgaggcgatgagcgatttgtatcagtgcatcaccaatggtcgcttatat
gcgtccgttgactccggcagtttgagtgagcgtgatgtggttgacgattacattcagcgt
attgctgatgatgtgcagttgaatcgtccgctgaagattgttgttgatcctggtcacggt
gcggctgaagagatcctgtcacgtttatttaaggcgattggtgcggatctggtgtcactg
tacggtgatattgatggtgtttcccttattgtccatcctgattcgggcgagccagggaat
ctgcagaagttgattcagcgggttgagcgggccgatgccgatttgggtcttgcttttgat
ggggatgcggaaagtctcagagtggtgactcgagaaggtgaggtcattttatcggatagc
gtgttgatgttgtttgcgacggatgtgctacagaggaatccgggtgctttggtgatctat
gatgctgaatgtactagcaagttgtctgattatgtattgcgcaatggcggcagcccgttg
atgtggaagatagggcattcctccatcaaagctaagatgcgcgagaccggtgccgagttg
gctggtgaaatgagtggctatttcttcttcaaagaacgctggtatggttttgaggatgct
ctgtatgcggcggcgcgtttgctggagatcttagcgcagcgcgaggataatccgtctcag
gtgtttgctgcattgccccatgcttatttcactgcgcaaatggagcagtctgtcgagggt
gatgcgcaggcatgtgtacagtcctttattgaggaagtgcagcgtagcgttgagggcggt
gtgttcgatggtgctcgtttgttcgcctttgatggtttgcgtgctgatttcactgatggt
tgggggctagtacgcgtttctgacactgcatctgcactggtgttgcgttttgaggctgac
acgcaggctggattggagcggattcagagtgcattccgcacgcatctgcaggcattacta
cccggtcaggtactggtgttctaa

DBGET integrated database retrieval system