KEGG   Xylella fastidiosa M23: XfasM23_0113Help
Entry
XfasM23_0113      CDS       T00692                                 

Definition
phosphoglucomutase/phosphomannomutase subunit alpha/beta
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
xfn  Xylella fastidiosa M23
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:xfn00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:xfn00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:xfn00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:xfn00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xfn00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:xfn00520]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:xfn00230]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:xfn00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
151926..154469
Genome map
AA seq 847 aa AA seqDB search
MSVTIGNELILPMKRRRIAFLLAMLCLLLAGVFCWGAYIQWRQNVVQQKLEQARDGAVAS
LLQVLSAQVKQLQNVVQRPAIVQVLGGGDVTAAAAAVREQFPGTEDVQVLTGDLSAAYAD
VARSGYARLGLIEAALGGDGVKAWVVRDGTQIGLGMAVMVKLGQAPAVVYLRLPLRGLIS
VLDAIEVPNSTYLALRQGSYTVVERGSAALASGGEALAKPLGWADLRMAAAVPQLENVPF
DLGLLPSLIVVGVFALVAAVLLLVAGGHRMLPRRHGQMADAEQEQVTLRESVMQEAPERA
IVLNDENKENKENKENKENKENKENKENKENKENKENKENKENKENKENKENKENKENKE
NKENKENNVALSSSLHLQFNLEAVVQPSLFHEDDIHGVVPSELNPGVAKLIGQAIGSAMQ
AKGLSDIVIGRDGRVSSSELSAALSDGLRHAGCNVVDIGLVPIPVVYFAACHLGVWSCVA
VTGGHHPHDYNGFKIVLGGESLSSEAMSDLYQCITNGRLYASVDSGSLSERDVVDDYIQR
IADDVQLNRPLKIVVDPGHGAAEEILSRLFKAIGADLVSLYGDIDGVSLIVHPDSGEPGN
LQKLIQRVERADADLGLAFDGDAESLRVVTREGEVILSDSVLMLFATDVLQRNPGALVIY
DAECTSKLSDYVLRNGGSPLMWKIGHSSIKAKMRETGAELAGEMSGYFFFKERWYGFEDA
LYAAARLLEILAQREDNPSQVFAALPHAYFTAQMEQSVEGDAQACVQSFIEEVQRSVEGG
VFDGARLFAFDGLRADFTDGWGLVRVSDTASALVLRFEADTQAGLERIQSAFRTHLQALL
PGQVLVF
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgacaattggaaacgagttgattttgccgatgaaacgacgccggattgcattt
cttttggcgatgttgtgtttgttgctggcaggggtgttttgttggggggcgtacatacag
tggcgccagaatgtggtgcagcagaagctcgagcaggcacgtgatggtgctgttgcgtca
ttgcttcaggtgctgtctgctcaggttaagcagttgcaaaatgtggtgcagcgtccggcc
atcgtacaggtgctgggtggaggtgacgtcacggcagcagctgcagcggttcgtgagcaa
tttccaggcactgaggatgtacaggttctgaccggcgatctgagtgctgcttatgcggat
gtggcgcgctccggttatgcccgccttgggctgatagaggcggctcttggtggtgatggt
gtgaaggcatgggttgtacgtgacggtactcagattggcttgggtatggctgtgatggtc
aagcttggccaagctccggcggtggtctatcttcgcctgccgctacgtggcttgataagt
gtgttggatgcgattgaggtgcccaatagcacttacttggcattgcgtcaggggagttat
acggtggtcgagcgcggtagcgccgcgttagccagtggtggtgaggcattggctaaaccg
ctgggttgggctgacttgcgtatggctgccgctgtgccgcagctggaaaacgtccctttt
gatttgggattgctgccatctttgattgtggtaggggtgtttgcgctagttgcggcggtc
ctgttgttagttgcgggtgggcataggatgctacccaggcgtcacgggcaaatggccgat
gcagaacaagaacaggttactttgcgtgaaagtgtgatgcaggaggcgccggagcgcgcg
atcgttttgaatgacgaaaacaaggaaaacaaggaaaacaaggaaaacaaggaaaacaag
gaaaacaaggaaaacaaggaaaacaaggaaaacaaggaaaacaaggaaaacaaggaaaac
aaggaaaacaaggaaaacaaggaaaacaaggaaaacaaggaaaacaaggaaaacaaggaa
aacaaggaaaacaaggaaaacaacgttgcgttgtcgtcgtcgctgcatcttcagttcaat
ttggaagcggtggttcaacctagtcttttccatgaagacgatatccacggtgtggtccct
agcgagttgaacccaggtgtggcgaagttgatcggtcaagcgatcggcagtgcgatgcag
gccaaaggtttgagtgacattgtgattggccgtgacggccgcgtgtccagttctgagttg
tccgcagcattaagtgatggtctacgtcatgccggttgcaatgtggtagacatcggcttg
gtgccgatccctgtagtgtatttcgctgcctgccatcttggcgtttggagttgcgttgcg
gtcacaggggggcatcatcctcatgattacaacggtttcaagatcgtgcttggtggtgag
tccttatccagtgaggcgatgagcgatttgtatcagtgcatcaccaatggtcgcttatat
gcgtccgttgactccggcagtttgagtgagcgtgatgtggttgacgattacattcagcgt
attgctgatgatgtgcagttgaatcgtccgctgaagattgttgttgatcctggtcacggt
gcggctgaagagatcctgtcacgtttatttaaggcgattggtgcggatctggtgtcactg
tacggtgatattgatggtgtttcccttattgtccatcctgattcgggcgagccagggaat
ctgcagaagttgattcagcgggttgagcgggccgatgccgatttgggtcttgcttttgat
ggggatgcggaaagtctcagagtggtgactcgagaaggtgaggtcattttatcggatagc
gtgttgatgttgtttgcgacggatgtgctacagaggaatccgggtgctttggtgatctat
gatgctgaatgtactagcaagttgtctgattatgtattgcgcaatggcggcagcccgttg
atgtggaagatagggcattcctccatcaaagctaagatgcgcgagaccggtgccgagttg
gctggtgaaatgagtggctatttcttcttcaaagaacgctggtatggttttgaggatgct
ctgtatgcggcggcgcgtttgctggagatcttagcgcagcgcgaggataatccgtctcag
gtgtttgctgcattgccccatgcttatttcactgcgcaaatggagcagtctgtcgagggt
gatgcgcaggcatgtgtacagtcctttattgaggaagtgcagcgtagcgttgagggcggt
gtgttcgatggtgctcgtttgttcgcctttgatggtttgcgtgctgatttcactgatggt
tgggggctagtacgcgtttctgacactgcatctgcactggtgttgcgttttgaggctgac
acgcaggctggattggagcggattcagagtgcattccgcacgcatctgcaggcattacta
cccggtcaggtactggtgttctaa

DBGET integrated database retrieval system