KEGG   Xylella fastidiosa M23: XfasM23_0197Help
Entry
XfasM23_0197      CDS       T00692                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
xfn  Xylella fastidiosa M23
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:xfn00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:xfn00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
267292..267849
Genome map
AA seq 185 aa AA seqDB search
MKVIDTALPGCLVIEPRVFDDARGEFFEVWNAECFEHQGMSSRFVQSNVSISIYGVLRGL
HYQWPRPQGKLVGVLEGEVYDVAVDIRRGSPHYGRWVAVLLSAKNKRQLWIPEGFAHGFV
VLSERAVFNYLCTDVYVKEADAGIRWNDAVIGVDWPIAAPLLSAKDQKAPFMEEVPIDRL
PIYVP
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtgattgatacggcgctgccaggctgtttggtgattgagccgagggtgtttgat
gatgcgcgcggtgaattttttgaggtatggaatgcggagtgtttcgagcaccaggggatg
tcatcgcgctttgtgcagagtaacgtgtccatatcaatttatggtgttttgcgtggtttg
cattatcagtggccgcgtccgcaggggaagttggtcggtgtgttggagggtgaggtttac
gatgttgctgttgatatccgccgtggctcgccgcattacgggcgttgggtagcggtgttg
ctcagtgccaaaaacaagcgccagttatggattccggaagggtttgcgcacgggtttgtg
gtgttgtctgagcgtgcggtattcaactatctgtgtacggatgtgtatgtgaaggaggcc
gatgctggcatccgttggaatgatgcggtgattggtgtggattggccgattgctgcgccg
ctgctctcggctaaggatcagaaagcgccgtttatggaggaagtccctattgatcgtttg
ccgatatacgtgccgtga

DBGET integrated database retrieval system