KEGG   Xylella fastidiosa M23: XfasM23_0209Help
Entry
XfasM23_0209      CDS       T00692                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
xfn  Xylella fastidiosa M23
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xfn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XfasM23_0209
   01230 Biosynthesis of amino acids
    XfasM23_0209
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XfasM23_0209
   00030 Pentose phosphate pathway
    XfasM23_0209
   00051 Fructose and mannose metabolism
    XfasM23_0209
   00052 Galactose metabolism
    XfasM23_0209
  Energy metabolism
   00680 Methane metabolism
    XfasM23_0209
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    XfasM23_0209
Enzymes [BR:xfn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     XfasM23_0209
Protein phosphatases and associated proteins [BR:xfn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     XfasM23_0209
Messenger RNA biogenesis [BR:xfn03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     XfasM23_0209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(282570..283823)
Genome map
AA seq 417 aa AA seqDB search
MAKETLLYAQSGGVTAVINATAAAVITEARSHRIKVLAARNGILGALREDLIDTSKESIT
AIRALTHTPGGAFGSCRFKLKSLEADHEKYERLLEVFKAHNVRWFLYNGGNDSADTALKV
SQLAKTFDYPLHCIGVPKTIDNDLAITDASPGFGSAAKYTAVSICEAARDVAAMAETSTK
VFIYEAMGRHAGWLAAAAGLAGQGQEEAPHIILLPERTYDETAFLAKVQQVVDRVGWCVV
VASEGIRSNDGRFVADAGGTTDAFGHTQLGGVAAYLANRVKQALGLKVHWTLPDYLQRSA
RHIASKTDWEQAQAVGKAAVHYALEGMNAVMPVIVRTSDTPYRWKIEPAALTKIANHEKT
LPASFLRRDGFGISERARTYFEPLIRGEAPMPYERNGLPRHVHLKNQSVQKRLPAWE
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagagacgttgttatacgcccaatccggcggcgttaccgctgttatcaacgca
accgccgccgcggtcatcaccgaagcacggtcacaccgcattaaagtcctcgccgcacgc
aatggcatcctcggtgcactgcgtgaagacctgatcgatacatccaaagaatcaatcacg
gcaatccgtgccttgacccataccccaggaggcgcatttggctcgtgccgtttcaagctc
aaatcgcttgaagccgatcacgaaaaatacgaacggttacttgaagtattcaaagcacat
aacgtgcgctggttcctctacaacggtggtaatgactccgccgatacagcgctcaaagtc
tcacagttagccaaaacatttgactatccactgcactgtatcggcgtccctaaaaccatc
gacaacgatttggcgatcaccgacgccagccccggcttcggttcagccgcaaagtacact
gctgtctccatatgcgaagccgcgcgggatgtcgcagcgatggccgagacctcaactaag
gttttcatttacgaagcaatgggccgccatgccggttggctcgctgcggctgctggcttg
gccggccaagggcaggaagaagccccccacatcatcctgctccctgaacgcacctacgac
gaaacagcatttctggcgaaagtccaacaggtagtcgaccgagtcggttggtgcgtagta
gtcgccagcgaaggtatccgcagcaatgatgggcgcttcgttgccgatgctggcggcacc
actgatgcctttggtcacacgcaacttggcggcgtcgccgcttacctcgccaaccgagtg
aaacaggcactcggactcaaagtgcactggacgctgccagattacctacaacgctccgca
aggcacatcgcctccaaaacagactgggaacaagcacaggctgtgggtaaagctgcagtg
cactacgcactggaaggcatgaatgcagtcatgcctgtcatcgtacgcacctctgacacc
ccataccgttggaaaatcgagccggcagcactcaccaagattgccaatcacgaaaaaacc
ttaccagcaagcttcttacgccgtgacggcttcggcatcagcgaacgtgcacgcacctac
tttgaaccattgattcgtggcgaagcacccatgccctacgaacgcaacggattaccgcga
cacgtccatctgaaaaatcaaagcgtacagaaacggctacctgcctgggaataa

DBGET integrated database retrieval system