KEGG   Xylella fastidiosa M23: XfasM23_0238Help
Entry
XfasM23_0238      CDS       T00692                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
xfn  Xylella fastidiosa M23
Pathway
xfn00010  Glycolysis / Gluconeogenesis
xfn00051  Fructose and mannose metabolism
xfn00562  Inositol phosphate metabolism
xfn01100  Metabolic pathways
xfn01110  Biosynthesis of secondary metabolites
xfn01120  Microbial metabolism in diverse environments
xfn01130  Biosynthesis of antibiotics
xfn01200  Carbon metabolism
xfn01230  Biosynthesis of amino acids
Module
xfn_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xfn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XfasM23_0238
   00051 Fructose and mannose metabolism
    XfasM23_0238
   00562 Inositol phosphate metabolism
    XfasM23_0238
Enzymes [BR:xfn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     XfasM23_0238
Exosome [BR:xfn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   XfasM23_0238
  Exosomal proteins of bladder cancer cells
   XfasM23_0238
  Exosomal proteins of melanoma cells
   XfasM23_0238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACB91689
JGI: XfasM230238
UniProt: B2I782
Position
316138..316887
Genome map
AA seq 249 aa AA seqDB search
MRPKIVAGNWKLHGSHAFAQALVAQVAAGLPLPGVSVIILPPLLYLSDLAQRFKGEGLAF
GAQNVSHHDKGAYTGEVSAAMVADVGAHYTLVGHSERREYHHEDSELVARKFAAALSAGL
RPILCVGESLPQREAGQAEVAIAMQLAPVLALVGPQGVARGLIAYEPVWAIGTGRHADPS
QVQAMHAFIRGEIARQDARIGDSLLILYGGGIKPCNAAELFSQQDVDGGLIGGASLVADD
FLAIARATV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcccaagattgtggctgggaattggaagttgcatggtagccacgcgttcgcacag
gcattggttgcgcaggtcgctgctggtttgccgctgcctggagtcagtgtgattatcttg
ccgccattgctgtatctgagtgatttggcgcagcgcttcaaaggggaaggtttggcgttt
ggtgcgcagaacgtcagtcaccatgataaaggtgcttacactggggaagtttcggcggcg
atggtggctgatgtcggtgctcattacactttggttgggcattctgaacgtcgggagtat
caccatgaggacagtgagttggtggcgcgtaaatttgctgctgctctgagtgctgggttg
cgaccaattctatgtgttggggagagtttgccccagcgtgaggctggacaggcagaggtt
gccattgcgatgcagcttgcgcctgtgttggctctggttggcccgcagggtgttgcccgt
ggcttgattgcctatgagccggtttgggcgattggtactggccgtcatgcggatccgagc
caagttcaagcgatgcacgcttttattcgtggtgaaattgcgaggcaagatgctagaatc
ggcgattctctgttgattctatacggaggcggcatcaagccttgcaatgctgctgagttg
ttttcccagcaggatgtcgatggtgggttgattggtggtgcttcgttggttgctgatgat
ttcttggctatcgctcgtgcgacggtttag

DBGET integrated database retrieval system