KEGG   Xylella fastidiosa M23: XfasM23_0324Help
Entry
XfasM23_0324      CDS       T00692                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
xfn  Xylella fastidiosa M23
Pathway
xfn00900  Terpenoid backbone biosynthesis
xfn01100  Metabolic pathways
xfn01110  Biosynthesis of secondary metabolites
xfn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xfn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XfasM23_0324
Enzymes [BR:xfn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     XfasM23_0324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Semialdhyde_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ACB91772
JGI: XfasM230324
UniProt: B2I7P4
Position
complement(421558..422742)
Genome map
AA seq 394 aa AA seqDB search
MTKPIRNVAVLGATGSIGAAALDVLARHPRQFHVSLLAAGQRVDALLALCRTYRPDHAVI
GDATLYTTLRDGLNAAGLATKAYAGEAALAELVASTTCDTVVAAIVGAAGLHSTLAAARA
GKRLLLANKESLVLAGMLLMREASISGAEIIPIDSEHNAIFQCLRSRTTDGVHRVTLTAS
GGPFRGHNRTMLAKITPTQAMAHPTWSMGPKISVDSATLMNKGLEVIEAHHLFGLPSEQI
DVLVHPQSLVHSLVEFIDGSTLAQLSLPDMRTTLAVGLAWPERIGSGVQGLDLMKHNRLD
FEHPDTETFSCLRLARDAMQTGGTAPAVLNAANEIAVSAFLQGRIGFLTIPALIEHALTT
LPRYEADTLETLLTVDTETRRITHAALTHFPLPL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaccgatccgcaacgtcgccgtactcggtgccactggctcaattggggcagca
gcactggatgtgctcgcacgccaccccagacagttccacgtaagcctgctagccgctggc
cagcgcgtcgatgcactgttggcattgtgccgcacgtatcgtccggaccatgcggtgatc
ggcgatgcaacgctctacaccactcttcgcgacggcctgaatgccgctggtttagccacc
aaagcgtacgctggagaagcagcattagcagaactagtcgccagcaccacatgcgatacc
gtagtggcagcaatcgtcggagcagcgggcctccattcgacactggcggcagcacgcgcc
ggaaaacgtctgttgctggcgaacaaagaatcgctggtcctggccggaatgctgctgatg
cgtgaggccagcatcagtggcgcggagatcataccgatcgatagcgaacacaacgcaatt
tttcagtgcctgcgttcgcgtactacagatggcgtgcatcgggtcactttgactgcttct
ggcggtccatttcgtggccacaaccgcacgatgctagccaagatcactcccactcaagca
atggcccacccaacgtggtcgatgggaccaaagatatcggtagattcggctacactgatg
aacaagggcttggaagtcattgaggcccaccatttgttcgggctacctagcgaacagatt
gatgtactagtgcatccacaaagtttggtgcactctctggtggagtttattgatggttcg
acgctcgctcagttaagcctgccagacatgcgtaccaccctggcagttggcctcgcctgg
ccagagcgaatcggttccggggtgcagggtttggacttgatgaagcacaacaggttggac
tttgagcatccggataccgaaacgttttcctgtctgcgtctggcacgagacgccatgcag
actggcggcacggcgcctgcggtgctaaatgctgccaatgaaatcgctgtttcagcgttt
cttcaggggcgcatcggtttcctaacaattccagcactgatagaacacgcactgactaca
cttcctcgttacgaggcagacactttggagactctactgaccgtggacacagaaacccgc
cgcatcacacacgcagcactcacccatttcccactccctctctaa

DBGET integrated database retrieval system