KEGG   Xylella fastidiosa M23: XfasM23_0343Help
Entry
XfasM23_0343      CDS       T00692                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
xfn  Xylella fastidiosa M23
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:xfn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XfasM23_0343
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XfasM23_0343
   00650 Butanoate metabolism
    XfasM23_0343
  Energy metabolism
   00190 Oxidative phosphorylation
    XfasM23_0343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
441035..441418
Genome map
AA seq 127 aa AA seqDB search
MSRYRTPLKNARGLGAAKVGTGHFVLQRLTAIALVLLGVWFLAFLLTLLGVDYAAAVAAV
AKPWNAILLIGFLVAAFWHAQLGLQVVLEDYIHNSFLALTLQTMVRFIAVLGAVASVFAV
VRIALGN
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgttaccgtacaccactcaaaaatgcccgtggtctaggtgctgctaaggtgggg
accgggcattttgtgttgcagcgcctcactgcgattgcattagtattgctgggagtatgg
tttttggcatttttgctgactttgcttggtgtcgactatgcagcagcggttgcagccgtc
gccaaaccttggaatgcaatattgctcattggattcctggtcgctgccttttggcatgcg
cagctcggtttgcaggtggtacttgaggattacatccacaactcttttctggctttgaca
ctccagacgatggtgagatttatcgctgtccttggcgcggtcgccagcgtttttgcggtc
gttcgtatcgcgcttgggaactga

DBGET integrated database retrieval system