KEGG   Xylella fastidiosa M23: XfasM23_0540Help
Entry
XfasM23_0540      CDS       T00692                                 

Definition
arginase/agmatinase/formiminoglutamase family protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
xfn  Xylella fastidiosa M23
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xfn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XfasM23_0540
  Amino acid metabolism
   00330 Arginine and proline metabolism
    XfasM23_0540
Enzymes [BR:xfn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     XfasM23_0540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
638722..639618
Genome map
AA seq 298 aa AA seqDB search
MMKDAMSIVKKKTIRMLFPQWQGGNQELYGLGARLLAWLAPETEAPMFEVNVPEFKKETP
EPERGVIYRQQLFKQYDEAYRLLEREDPDYVVIFGGDCLVDLAPFAWLNEKHHGQLGVLW
IDAHPDIKTPQDSINGHTMVLGSLLGEGDNEFAAKVKVPLKPSRVMFAGLIETGLTEQET
EVIHRLGLNVAKPEVLFDNSQTVIDWVRKEKIEKLVIHFDLDVLHPDVFRSLLFAEPEPE
FDWRATYPVGQLRLAQVIRLIRDVAAETELVAIGITEHLPWDVWHLKESLSKVPLLNR
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaggacgcaatgagtatagttaagaagaaaacaatcagaatgctgtttcctcaa
tggcaaggtggaaatcaggagctatatggtttgggcgcacgtcttctggcttggttggcg
ccggaaacagaggcgcctatgtttgaggtgaatgtgcctgagtttaaaaaagaaacgccc
gaaccggagagaggggttatctacaggcagcaattattcaagcagtatgatgaagcttat
cgactgttggagcgggaagatccggattatgtggtgatctttggtggtgattgcctggtg
gatttggcgccttttgcttggttgaatgagaaacatcatggtcagttgggtgtgttatgg
attgatgctcatcctgatataaaaacaccacaggattctataaatggtcacacgatggtt
ctgggaagtttgctgggtgaaggtgataacgaatttgccgcaaaggtgaaagttccgctg
aagccgtccagggtgatgtttgcagggttgattgaaacggggttgacggagcaggagact
gaggtaattcatcgccttggactcaatgtggccaaaccggaggtgttatttgacaacagc
cagacggtgattgattgggtccgtaaggagaaaatcgagaagttggtgattcatttcgat
ctggacgttcttcatcctgatgtattccgctcgttgttatttgccgagccggagccggaa
ttcgattggcgggcaacttacccggttgggcaattgcgtttggcacaggtgatcaggttg
attcgcgatgttgccgctgaaacggagttggtggctattggcataactgagcatcttcct
tgggatgtttggcacttgaaggagtctttaagtaaggttccattgctgaatcggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system