KEGG   Xylella fastidiosa M23: XfasM23_0644Help
Entry
XfasM23_0644      CDS       T00692                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
xfn  Xylella fastidiosa M23
Pathway
xfn00260  Glycine, serine and threonine metabolism
xfn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xfn01100  Metabolic pathways
xfn01110  Biosynthesis of secondary metabolites
xfn01130  Biosynthesis of antibiotics
xfn01230  Biosynthesis of amino acids
Module
xfn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xfn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XfasM23_0644
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XfasM23_0644
Enzymes [BR:xfn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     XfasM23_0644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACB92086
JGI: XfasM230644
UniProt: B2I9J2
Position
760716..761933
Genome map
AA seq 405 aa AA seqDB search
MSDITVANYHAFPDARGHFGRYGGRFVAETLIGPLQELAQAYDAARHDPDFIAAYNKDLK
DYVGRPSPIYHAERLSRKVGGAQILLKREDLNHTGAHKINNTIGQALLAARMGKTRIIAE
TGAGQHGVASATVAARLGLECVVYMGATDIQRQQINVYRMKLLGATVVPVTSGSATLKDA
LNEAMRDWVTHVGHTFYIIGTVAGPDPYPRMVRDFNAIVGREARAQMIEDYGRLPDAMTA
CVGGGSNAIGLFHAFLNDASVRIYGAEAAGDGIATGRHAASIVAGRPGVLHGNRTYVVCD
DDGQILETHSVSAGLDYPGVGPEHAFLADSGRVQYVGIRDEEALAAFHLLAHTEGILAAL
ESSHAVAHTMTLARDLPKDALVLCNLSGRGDKDVHTIAAREGVRV
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatattactgttgctaactatcatgctttccctgatgctcgcggccattttggg
cgttacggtggtcgttttgttgctgaaacgttgatcggaccgttgcaggagcttgcacag
gcctatgatgcggcgcgccatgatcccgatttcatcgccgcttataacaaggatctcaag
gattatgtgggtcgccccagtccgatctaccatgctgaacggctgagccgtaaggtgggt
ggcgctcaaattctgttgaagcgtgaggatcttaatcacaccggtgcgcacaaaatcaat
aacaccattggccaggccttgctggcagcacgtatgggcaagacacgcatcattgccgag
actggagccggtcagcatggtgtcgccagtgctactgtcgctgcgcgtttgggtttggag
tgtgtggtgtatatgggggctacggatatccagcggcagcagatcaacgtgtatcggatg
aagttgttgggtgcgacggtggtgcccgtgacttccggttcagccacactcaaggatgcg
cttaacgaagcgatgcgtgattgggtgacgcatgtggggcatacgttttatatcattggc
actgttgctggcccagatccgtatccgcgtatggtgcgcgacttcaacgcaattgttggc
cgtgaggcacgtgcgcagatgattgaagattatgggcgtttaccggatgcgatgactgct
tgtgttggcggtgggagtaatgccattggtttgttccatgccttcctcaatgatgcttcg
gtcaggatctatggtgctgaggcggctggagacggcattgcgacgggccgtcacgcggcc
tcaattgttgccggtcgtccgggagtgttgcatgggaatcgcacctacgtggtgtgtgat
gatgatggacagattttggaaacccattctgtatcagccggtttggattatccgggggtt
ggtcctgagcacgcttttttggctgacagtggccgggtgcagtatgtggggattcgggat
gaagaagcgttggctgcattccacttgcttgcacatactgaaggcatcttggctgcattg
gaatccagtcacgctgtggcccataccatgacgttggcgcgcgatcttcccaaagatgca
ttggtactgtgtaacttgtccggtcgcggtgataaggatgtgcacacgatcgcggcgcgc
gaaggtgtacgtgtctga

DBGET integrated database retrieval system