KEGG   Xylella fastidiosa M23: XfasM23_0645Help
Entry
XfasM23_0645      CDS       T00692                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
xfn  Xylella fastidiosa M23
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xfn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XfasM23_0645
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XfasM23_0645
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XfasM23_0645
Enzymes [BR:xfn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     XfasM23_0645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
762059..762865
Genome map
AA seq 268 aa AA seqDB search
MHRIDETFRRLRAQSRKALIPFITAGDPSLEAAVPVMHALVRAGADVIELGVPFSDPMAD
GPVIQHSSERALQRGVGLAYVLQTVDVFRQSDAVTPVVLMGYLNPLEIYGIARFTQQALA
SGVDGVLLVDLPPEEADEIRAIFSAAGLALIVLASPTTSASRLATLSGVAQGYLYYVSFA
GVTGADRLDAQSAGDRLRGLRAQTQVPVVVGFGIRDAASAVVMAVDADGVVVGSALVTAL
SDAPDVDTACRRADAFLAPLRQALDAVK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgtatagacgaaacattccgccgtttaagggcgcaatcgcgcaaggcgttgatc
cctttcatcactgctggcgacccctctttggaggcggctgttccggtgatgcatgctttg
gtccgtgcgggtgcggatgtgattgagttgggtgtgccgttttcggacccgatggcggat
ggtccggtgattcagcacagttccgagcgcgcgttgcagcgtggtgtgggtttggcctat
gtgttgcagacagtcgatgtgttccgtcagagtgatgcagtgacgccggtggtcttgatg
ggctacctcaatcctttggaaatctatggcattgcgcgttttacacagcaggcactggct
tctggagtggatggggtgctgcttgtggatcttcctccggaagaggcggacgagatccgc
gcgatcttttcggcggctggtttggcactcatcgttttggcatctccgacgacctctgcc
tcccgtctggccacgttgagtggggttgcccaggggtacttgtattacgtgagttttgct
ggcgtgactggtgctgatcggcttgatgcgcagtcagccggtgatcgcttgcgtggatta
cgtgcgcagactcaagtcccggtggtggttggctttggtatcagggatgcggccagtgct
gtggtgatggcggtggatgcggatggggtggtggttggcagtgccttggtgacggcctta
agtgatgctccggatgtggacaccgcctgccggcgtgctgatgcgtttttggcaccgttg
cgtcaggcgttggatgcggtgaagtag

DBGET integrated database retrieval system