KEGG   Xylella fastidiosa M23: XfasM23_0710Help
Entry
XfasM23_0710      CDS       T00692                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
xfn  Xylella fastidiosa M23
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xfn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XfasM23_0710
Enzymes [BR:xfn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     XfasM23_0710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
839755..840330
Genome map
AA seq 191 aa AA seqDB search
MPMTEVDVVSGYMREYGMTSVLLSLGSNVRPRYYLSQAEAALHAFFGEVLFSPVYRTLAV
GFDGPDFLNSAAMVHTAMSLSDLLAWLQVAWLHALEERYGRDRAEPRFGNRTLDVVFYGD
LIVKEPGGEYCIPRRELKHSFVLKPLVDVAPDFVDPVSGRTLAQLWAVHPHVDACFQAVD
LEVPGDDRDMI
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgacggaggttgacgttgtctctggttacatgcgcgaatatggcatgactagt
gtgcttctgagtttaggtagtaatgttcgtcccaggtattacttgagtcaggcagaagct
gcattgcacgctttttttggtgaagtgttgttttctcctgtctaccgcactttggctgtg
ggttttgacggtccggatttccttaatagtgctgccatggtgcataccgctatgtctctg
tcagatttgcttgcatggttgcaggttgcatggttgcatgcgttggaggaacgctatggc
cgtgatcgcgccgagccgcgttttggtaaccgtaccctggatgtggtgttctatggtgat
ctgatcgtgaaagaaccaggtggggaatactgtattccacgccgtgagttgaagcatagt
tttgtgcttaaaccattagtggatgtggcaccggattttgtcgatccagtcagtgggcgt
accttggcgcagttgtgggcggtgcatccacacgtcgacgcatgtttccaggccgtggat
cttgaagtacccggtgacgatagagacatgatttag

DBGET integrated database retrieval system