KEGG   Xylella fastidiosa M23: XfasM23_0756Help
Entry
XfasM23_0756      CDS       T00692                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
xfn  Xylella fastidiosa M23
Pathway
xfn00230  Purine metabolism
xfn01100  Metabolic pathways
Module
xfn_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:xfn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    XfasM23_0756
Enzymes [BR:xfn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     XfasM23_0756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 RsgA_GTPase MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: ACB92195
JGI: XfasM230756
UniProt: B2IA36
Position
complement(893320..893934)
Genome map
AA seq 204 aa AA seqDB search
MRGTLYIVSASSGTGKSSIVNATLERDQQIALSISFTSRQPRPNERHAQHYYFVSADEFQ
RMIEAGDFFEYALVHGDWKGTARQSVEPQLAAGHDVLLEIDWQGARQVRSKIPDAISIFI
LPPSRAALEERLRKRGQDSEEVIHLRLAAAHEEMAHYDEFDYTIINEHFETAVSEMSAIF
TASRLRRQTQKIRHANLIQTLLTP
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggcaccctctacatcgtttcagcctcttccggcactggtaaaagcagcatcgtc
aacgccactctggaacgcgatcaacaaatcgctctgtcgatctccttcacctcacgtcag
cccagacccaatgagcgccatgcacagcactactatttcgtctcagccgatgaatttcag
cgcatgattgaggcaggcgacttttttgaatacgcattggtccatggcgattggaaaggc
accgcccgccaatcggtggagccacaactggctgccggtcacgatgtactgttagaaatc
gactggcagggtgcacgccaagtgcgcagcaagatccctgatgcaatcagcatatttata
ttgccgccctcacgcgccgcactggaagaacgcctgcgtaaacgcggccaagacagtgaa
gaggtcatccatctgcgcttagctgccgcccacgaagaaatggcgcactacgatgaattc
gactacacgattattaatgagcatttcgaaactgcagtttcagaaatgagcgctatcttc
acggcaagtcggttgcggcgccaaacccaaaaaatacggcatgccaatctgatccaaacc
ttattaactccataa

DBGET integrated database retrieval system