KEGG   Xylella fastidiosa M23: XfasM23_0802Help
Entry
XfasM23_0802      CDS       T00692                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
xfn  Xylella fastidiosa M23
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:xfn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XfasM23_0802
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XfasM23_0802
  Amino acid metabolism
   00310 Lysine degradation
    XfasM23_0802
Enzymes [BR:xfn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     XfasM23_0802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(945765..946940)
Genome map
AA seq 391 aa AA seqDB search
MSTEVKVPVLPESVSDATIASWHKKAGEIVKRDENIVDLETDKVVLEVPSPVDGVLKEIK
FDAGSTVTSNQVLAIIEEGSIVTAPSPAPSQVIDQKPVAVSAPAAKSNVDSLPPGARFTA
TTEGIDPAQIEGSGRRGAVTKEDIINFAKQNGAARASGTRLEERIPMTRIRQRIAERLMQ
SKNSTAMLTTFNEINLAKVSNIRKELQEEFQKAHGIKLGFMSFFVKAAANALQRFPLVNA
SIDGTDIIYHGYSDISIAVSTDKGLVTPVLRNVERMSFADIEHRIADYAKKARDGKLSLE
ELQGGTFTVTNGGTFGSLLSTPIVNPPQSAILGMHTIKERPIAENGNIVIAPMMYVALSY
DHRIIDGKDSVQFLVDIKNQLEDPGRMLFGL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgaagttaaagtcccggtattacctgaatccgtttcagacgccaccattgcc
agctggcacaaaaaagccggtgagattgtcaaacgcgatgagaacatcgtcgacctggag
accgacaaagttgtattggaagtcccctcccctgtcgacggcgtcttgaaagaaatcaaa
ttcgacgccggcagtactgtcaccagtaatcaagttctggcaatcattgaagaaggcagc
atcgttactgcaccctctccagcaccctctcaggtgattgatcagaaaccggttgctgta
tccgctccagccgccaaatccaacgttgacagtctgcctccaggtgctcgtttcacggca
acgaccgaaggtattgacccagcccagatcgaaggaagtgggcgccgtggtgctgtcacc
aaagaagatatcatcaactttgctaagcaaaatggagccgcccgcgccagcggtacgcgt
ttagaagaacgcatcccaatgacccgtatccggcaacgcatcgccgaacgcctcatgcag
tcgaagaactccactgcgatgctgaccacctttaatgaaatcaacctggccaaagtctca
aacatacgcaaagagctacaggaagaattccagaaagcccacggtatcaaattgggcttc
atgagctttttcgtgaaagccgccgccaatgcactacagcgcttccccttggtcaacgca
tcaattgacggtacagacatcatttaccacggatatagcgatatttcgatcgcggtatcc
accgataaaggcttagtcacgccagtactgcgcaacgtcgaacggatgtctttcgccgac
attgagcatcgcatcgccgattacgccaagaaggcacgcgacggcaaattaagtctagaa
gagttgcagggaggcaccttcaccgtcaccaacggtggcacctttggctcattgctctcg
actccaatcgttaacccgccacaaagcgcgattttagggatgcataccatcaaagagcgc
cccattgctgagaacggcaacattgtgattgcgccaatgatgtacgtggcactgtcatat
gatcaccgcatcattgatggcaaagattcggttcaattcttggtggacatcaaaaatcaa
ttggaagaccccgggcggatgctgttcggcttataa

DBGET integrated database retrieval system