KEGG   Xylella fastidiosa M23: XfasM23_0802Help
Entry
XfasM23_0802      CDS       T00692                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
xfn  Xylella fastidiosa M23
Pathway
xfn00020  Citrate cycle (TCA cycle)
xfn00310  Lysine degradation
xfn01100  Metabolic pathways
xfn01110  Biosynthesis of secondary metabolites
xfn01120  Microbial metabolism in diverse environments
xfn01130  Biosynthesis of antibiotics
xfn01200  Carbon metabolism
Module
xfn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xfn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:xfn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XfasM23_0802
  Amino acid metabolism
   00310 Lysine degradation
    XfasM23_0802
Enzymes [BR:xfn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     XfasM23_0802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF2795
Motif
Other DBs
NCBI-ProteinID: ACB92241
JGI: XfasM230802
UniProt: B2IAG1
Position
complement(945765..946940)
Genome map
AA seq 391 aa AA seqDB search
MSTEVKVPVLPESVSDATIASWHKKAGEIVKRDENIVDLETDKVVLEVPSPVDGVLKEIK
FDAGSTVTSNQVLAIIEEGSIVTAPSPAPSQVIDQKPVAVSAPAAKSNVDSLPPGARFTA
TTEGIDPAQIEGSGRRGAVTKEDIINFAKQNGAARASGTRLEERIPMTRIRQRIAERLMQ
SKNSTAMLTTFNEINLAKVSNIRKELQEEFQKAHGIKLGFMSFFVKAAANALQRFPLVNA
SIDGTDIIYHGYSDISIAVSTDKGLVTPVLRNVERMSFADIEHRIADYAKKARDGKLSLE
ELQGGTFTVTNGGTFGSLLSTPIVNPPQSAILGMHTIKERPIAENGNIVIAPMMYVALSY
DHRIIDGKDSVQFLVDIKNQLEDPGRMLFGL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgaagttaaagtcccggtattacctgaatccgtttcagacgccaccattgcc
agctggcacaaaaaagccggtgagattgtcaaacgcgatgagaacatcgtcgacctggag
accgacaaagttgtattggaagtcccctcccctgtcgacggcgtcttgaaagaaatcaaa
ttcgacgccggcagtactgtcaccagtaatcaagttctggcaatcattgaagaaggcagc
atcgttactgcaccctctccagcaccctctcaggtgattgatcagaaaccggttgctgta
tccgctccagccgccaaatccaacgttgacagtctgcctccaggtgctcgtttcacggca
acgaccgaaggtattgacccagcccagatcgaaggaagtgggcgccgtggtgctgtcacc
aaagaagatatcatcaactttgctaagcaaaatggagccgcccgcgccagcggtacgcgt
ttagaagaacgcatcccaatgacccgtatccggcaacgcatcgccgaacgcctcatgcag
tcgaagaactccactgcgatgctgaccacctttaatgaaatcaacctggccaaagtctca
aacatacgcaaagagctacaggaagaattccagaaagcccacggtatcaaattgggcttc
atgagctttttcgtgaaagccgccgccaatgcactacagcgcttccccttggtcaacgca
tcaattgacggtacagacatcatttaccacggatatagcgatatttcgatcgcggtatcc
accgataaaggcttagtcacgccagtactgcgcaacgtcgaacggatgtctttcgccgac
attgagcatcgcatcgccgattacgccaagaaggcacgcgacggcaaattaagtctagaa
gagttgcagggaggcaccttcaccgtcaccaacggtggcacctttggctcattgctctcg
actccaatcgttaacccgccacaaagcgcgattttagggatgcataccatcaaagagcgc
cccattgctgagaacggcaacattgtgattgcgccaatgatgtacgtggcactgtcatat
gatcaccgcatcattgatggcaaagattcggttcaattcttggtggacatcaaaaatcaa
ttggaagaccccgggcggatgctgttcggcttataa

DBGET integrated database retrieval system